KEGG   Esox lucius (northern pike): 105016527
Entry
105016527         CDS       T04894                                 

Gene name
taf2
Definition
(RefSeq) transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
els  Esox lucius (northern pike)
Pathway
els03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    105016527 (taf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105016527 (taf2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105016527 (taf2)
   03036 Chromosome and associated proteins [BR:els03036]
    105016527 (taf2)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105016527 (taf2)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     105016527 (taf2)
   Coactivators
    SAGA/TFTC/STAGA complex
     105016527 (taf2)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     105016527 (taf2)
SSDB
Motif
Pfam: HEAT_2 Peptidase_M1_N Peptidase_M1 IL2
Other DBs
NCBI-GeneID: 105016527
NCBI-ProteinID: XP_019910341
UniProt: A0A3P9AMS5
AA seq 1219 aa
MHEIKMNRKKDKGFESPRPFKLTHQVVCINNINFQRKSVIGYVELTIFPTVVNLNRIKLN
SKQCRIYRVRVNDLEAPFIYNDPTLEVCHHESKQRNLNYFSSAYTAAVSAVDPDAGHGEL
VIKVPSELWKQGDEMNVLKVYIDFSLDQPKGGLHFVVPDVEGSMAERAAHVFSFGYQNST
RFWFPCVDSYSELCTWKLEFTVDSSMVAVSCGDLVETVYTHDMRKKTFHYVLPIPTAAPN
ISLAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSYLHEIFEFYEEILTCRYPYSCFKT
VFVDEAYVQVSSYASMSIFSTNLLHSAMIIDQTPLTRQCLAQALAQQFFGCFISRMSWAD
EWVLKGISGYIYGLYLKKTFGVNQYRHWIKEELDKIVEYELKMGGVLLHPTFVGGKDKDN
PTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQ
KYQSHMWSQMLVSTHGFLKSISNVSGKDIGPLIKQWVEQSAVVKFFGSFAFNRKRNVLEL
EIRQDYTSSGTQKYVGPIKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPL
MNGEEVDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEEAI
SALEKFPTPASRLALTDILEQDQCFYKVRQGACFCLAKIANSMMSTWTGPPAMKSLFTRM
FCCKSCPNIVKTNNFINFQSYFLQKTMPVAMAQLRDIQNLCPKDVLNFILDLIKYNDNRK
NKFSDNYYRAELIDALTNSLTPAISISNEVRTVDNLNGDVRLILEEITRFLNMEKLLPSY
RNTITVSCLRAIRTLQKNGHIPSDPSLFKSYAEYGHFVDVRVAALEAVVDYTRVDRSPVE
LQWLLNMVQNDPAHYIRHKILSMLGKNPPFTKAVDSPLCNEALVDQLWKLMNSGTSHDWR
LRCDAVNLYYTLFGLTRPSCLPLPELGLVLNLKEKKAVLNPTVKPEQGPGPAEVSGQPVA
VHLPVMGFTSSLDEGLITMETVSSVPIPSSVAPPPQGLKRKLDSVVGPLGSTSPEPGQVL
QEEDSSKKFKIRFNTAEEDEIDMESPHDSQAFIHHHLNMLERPSTPGKEPTAADQALLSL
PATPLPSFGKEANSSSKHGGGEHHHHHHHHHEHKKKKKKHKHKHKHKHKHDSREKERDSH
ACSNSPASGRSMRSPSVSD
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgcatgaaatcaagatgaatcggaagaaggacaagggttttgagagcccgcggcctttt
aaattgactcaccaggttgtctgcatcaacaatataaacttccaaaggaagtctgttatt
ggctacgtggagctgaccatcttcccgacagtggtcaacctgaaccggatcaagctgaac
agcaagcagtgccggatttaccgggtcagggtcaatgacctggaagcgcctttcatctac
aacgaccccacgctggaggtctgccaccatgagtccaagcagaggaatctgaactacttc
tccagcgcctacacggcggccgtcagcgccgtggacccagatgccggccacggggagctg
gtcatcaaagtgccctctgagctgtggaagcagggcgacgagatgaatgtgctgaaggtg
tatatagacttctccctggaccagcctaaaggaggcctccacttcgtggtacccgacgtg
gaggggagtatggcggagagagcagcacacgtcttttcctttggctaccagaactccact
aggttctggttcccctgtgtggactcatactcggagctgtgcacatggaagctggagttc
acagtggactcctccatggtggctgtctcctgtggggacctggtggagactgtttatacc
catgacatgaggaagaagacctttcactatgtccttccgatccccaccgcggcgcccaac
atctcgctggccgtcgggcccttcgagatcctggttgacccttacatgcacgaggtgacc
cacttctgtttgccccagctcctgcccctgttgaaacattccatgtcctacctccatgag
atctttgagttctacgaggagatcctgacttgtcgatacccctactcctgctttaaaact
gtctttgtggacgaggcgtacgtccaggtgtcctcttatgcttccatgagcattttcagt
actaatctgctccacagtgccatgatcatagatcaaactcccctgacccgacagtgttta
gctcaggccttggcccagcagttctttggttgcttcatctctaggatgtcctgggctgat
gagtgggttctgaaggggatatcgggttatatctatggtctgtacctgaagaagaccttt
ggagtcaaccagtaccgccactggatcaaagaggaacttgacaagatagtcgagtacgag
ctgaagatgggcggcgttctcttgcacccgaccttcgtgggaggcaaagacaaggacaac
cccacccctcacctccacttctcgatcaagcacccccacaccctctcatgggagtattac
aagatgtttcagtgtaaggctcacctggtcatgaggctgattgagaacaggatcagcatg
gaattcatgctccaggtgttcaacaagctcctgagtctggccagtaccgcctcttcccag
aagtaccagtcccacatgtggagtcagatgctggtgtcgacccacggcttcctcaagtcc
atctcaaatgtgtctgggaaggacatcggacctctcatcaagcagtgggtagagcagagt
gccgtggtgaagttctttggcagttttgccttcaacaggaaacggaacgttctggaactg
gagatccgccaggactacacctcctcaggaacgcagaaatatgtgggccccatcaaggtg
acggtccaggagctggatggatccttcaaccacaccctgcagattgaagagaacagcctg
aaacacgacatcccctgtcactccaagagcagacggaacaagaagaagaagatcccttta
atgaacggggaggaggtggacatggacctgtctgctatggatgccgattcgcccttgctg
tggatccggatcgacccagacatgtcaatcctgcgtaaggtggagtttgagcaggccgac
ttcatgtggcagtaccagctcaggtatgagcgtgacgtggtggcccaggaagaggccatc
tcagccctggagaagttccctacgccggcctcccgtctggcgctgaccgacatcctggaa
caggaccagtgcttctacaaggttcgccagggggcctgcttctgtctcgctaagatagcc
aactccatgatgagcacctggaccggacctccagccatgaagtccctgttcaccaggatg
ttctgctgcaagagctgccccaacattgtcaagaccaacaacttcatcaacttccagagc
tacttcctacagaagacaatgcctgtggccatggctcagcttagagacatccagaacctc
tgtcccaaagatgtcctcaactttatcctggacctcatcaagtacaatgacaacaggaaa
aacaagttttctgataactactaccgcgcagagctgattgatgctctgaccaactccttg
acccctgctattagcatcagtaacgaggtccgcacagtggacaacctcaacggagatgtt
cgcctgatcctcgaagaaatcacacgcttcctgaatatggagaaactgctgcccagctac
cgcaacaccatcactgtcagttgtctaagggctatccgaacactccagaagaacggacat
attcccagcgatccttctttgtttaaatcctatgctgagtacggacactttgtggatgtt
cgtgttgcagctctggaagccgtggtggactacacacgtgttgacaggagcccagtggaa
ctacagtggctgctaaatatggtccagaatgaccctgctcactacatcagacacaagata
ctgagcatgctgggtaaaaaccctcctttcaccaaagccgtggactctcctctctgcaac
gaggccttggttgaccagctgtggaagctcatgaactcagggacctctcacgactggcgc
ttacggtgcgacgcggtgaacctctactacaccctgttcggcctgacgcggccctcctgc
ctgcccctgccggagctgggcctggtgctcaacctgaaggagaagaaggccgtcctcaac
cccaccgtcaagccagaacagggcccggggccggcagaggtctctggccagcccgtggcg
gtccatctccccgtcatgggcttcaccagcagcctggatgaggggttaatcaccatggag
actgtgtccagcgtacctatccccagcagtgtggccccgcccccacagggcctgaagagg
aagttggacagcgtggttgggccactgggctccacctccccagaaccaggccaggtactg
caggaagaggacagcagtaagaaattcaagatcagattcaacaccgcggaggaggacgag
atcgacatggagagtcctcatgacagccaggcgttcatccaccaccacctcaacatgctg
gagaggccctccactccaggcaaggaaccgaccgcagcggaccaggccctgctgtccctg
cccgccacgcccttaccgtccttcggcaaagaggccaactcgtcctccaagcacggcggc
ggcgagcaccaccaccaccaccaccaccaccacgagcacaagaagaagaagaagaagcac
aagcacaagcataagcacaagcacaagcacgacagcagggagaaggagcgggactcgcac
gcctgcagcaacagcccggccagtggacgctccatgaggtctccatccgtgtccgattag

DBGET integrated database retrieval system