KEGG   Esox lucius (northern pike): 105016634
Entry
105016634         CDS       T04894                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105016634 (aff3)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105016634 (aff3)
SSDB
Motif
Pfam: AF-4_C PHC2_SAM_assoc
Other DBs
NCBI-GeneID: 105016634
NCBI-ProteinID: XP_028981717
AA seq 389 aa
MRHLYTPDTEGGDRRRKRKVENGVLHKESKRSNLPPQSPPVHATASRHQDPHSDTTHNGF
LEDFLDSKRPLSPLSPLSDTAEPPKPPAKTQHPGSSHPDKPRGQPKMEGVGVSGKPPPDC
ESWGSSLQRSVGPRGTVPPHEPPQHAEYYMHEAKRMKHRADAMVDKLGKAVNYVDAALSF
MECGKAMEDGPLEAKSPYTMYAETVELIRYAMRLKNHSGPGARQEDKQLAVLCFRCLALL
YWQMFRLKKDHALKYSKALLDYFKNSPKSSTGPIIWSDSGKGTGGPPTSQSPNSSGLSLG
SQPGSSPSSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADSLARDNKEFFNYLNTLSG
PLTLHSSIAHAVQYTRQALQWIRISAKVG
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgacacctctacacccccgacacagagggaggagacaggaggagaaaacgcaaggtg
gagaatggggtcctgcacaaagagagtaagaggagtaacctcccaccccaaagccccccg
gtccacgctacagccagcagacaccaggacccccactctgacaccacgcacaacgggttc
ttggaggacttcctggacagcaaaaggcctctgtccccgctgtcacccctgtcggacacc
gcagagcccccgaagccccccgccaaaacccaacacccgggttccagccacccggacaaa
cccaggggccagcctaagatggagggcgtgggggtgtcagggaagcccccgcctgactgt
gaatcctggggatcctctttacaacggtcggtgggaccaagaggaaccgttcccccacat
gaacccccacagcatgctgagtattacatgcatgaagccaagaggatgaaacatcgtgca
gatgccatggtggataagctggggaaggcggtgaactacgtggatgccgccctatctttc
atggagtgtggcaaagctatggaggacggaccgctggaggccaagtctccctacaccatg
tacgccgagactgtggagctcatccggtatgccatgagactgaagaaccactcaggtcca
ggagcccgacaggaggacaaacagctggccgtgctgtgtttccggtgccttgctctcctg
tactggcagatgttccgtttgaagaaggatcatgccctgaagtattccaaagccctcctg
gactacttcaagaactctcctaaatcctccaccggccccatcatctggagcgattctgga
aagggcactgggggacctcccacctcccaatcccccaactcctcaggcctttctctgggc
tcacaacctggcagctccccttcttctctcatcagcattccccagcgcatacaccagatg
gcggccaaccacctcaacatcaccaacagtgtcctctacagctatgagtattgggaggta
gcagatagcctggccagagacaacaaggagttctttaactacctgaacaccttatcggga
ccactgactctccatagtagtattgctcatgcagtccaatataccagacaggctctgcag
tggatacgcatcagtgccaaagtgggctaa

DBGET integrated database retrieval system