KEGG   Esox lucius (northern pike): 105016934
Entry
105016934         CDS       T04894                                 

Gene name
rnpep
Definition
(RefSeq) aminopeptidase B isoform X2
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105016934 (rnpep)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     105016934 (rnpep)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105016934 (rnpep)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Other DBs
NCBI-GeneID: 105016934
NCBI-ProteinID: XP_010879428
UniProt: A0A3P8Z2K2
AA seq 624 aa
MDESLHSDLAEDVSTSSSFRQFKIKHFHLDLSLDFEQRTLRGTETLQLKCIQDSQTELLM
DIHPSLSIQDVSFCGTEEDSGSVKVEFLTRNFTSYGTTLVVKCPSPCKIEEDIQVVIQFV
ASDGPGVCWLKPEQTAGKAKPYVFTQGQAVLNRSFFPCFDTPAVKSTYSASVKVPDGFTA
VMSASKGEHRKADNTFLFTMEQPIPSYLVALAVGDLVSAEVGPRTRVWTEPCLLQAATEE
YDGVIEEFLAVGEKLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADV
IVHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRVCTEIYGEAYASLEAATGRALLRQH
MDNTGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLAGEQSRFDAFLKAYI
DKFKFRSIMAEDALEFYLEYFPDLKKKDVHKIEGLEFDTWLNVSGWPPYLPDLSAGQSLM
KPAEQLSELWGAEGLDMTSIRKINIQAWKTYQTAYFLEKIIEKSPLPRGNIEKLEGEYPH
IVKSNNAELRLRWAQIIAKNQHQPGYQHVRNFLSCQGKQKYTLPVYRALWNGSEETRALA
TEIFNATSHQLHINVCKNVKKIIT
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggacgaatctctgcactcggacttagcagaggacgtatctacgtcctcgagctttcgt
caattcaaaataaaacacttccacttggatctaagcttggattttgaacagagaactttg
agagggactgaaacactacagctgaaatgcatccaagattctcaaaccgagctactgatg
gacattcacccttctctctccattcaggatgtgtccttttgtggaactgaagaagattcg
ggttcagtaaaagtagaattccttacgcggaacttcaccagttatggcaccacactggtt
gtgaaatgtccatcaccatgtaaaattgaggaggatattcaagtggtgatccagtttgtt
gcatccgatggaccaggggtgtgctggctgaaaccagagcagacggctgggaaggccaaa
ccctacgtcttcacccagggccaggccgtactcaaccgctccttcttcccttgctttgat
acgccagctgtcaagagcacctactcagcctctgtgaaggtccctgacggtttcacagcc
gttatgagtgccagtaagggtgagcacaggaaggcagacaacacattcctgttcactatg
gagcagcccatcccctcgtacctggtggccttggctgtgggagacctagtctctgctgag
gttgggccacggaccagagtgtggacagagccatgcctactccaggctgccacagaggag
tatgatggagtcatagaggagttcctagctgtgggggagaaactatttggaccctacgtc
tggggaaggtatgatgtgctgttcatgccaccgtcattcccattcggaggtatggagaac
ccctgcctcacatttgtcaccccctgcctcttggccggagaccgctccctggctgatgtc
attgtgcatgagatctgccatagctggtttggtaacttggtaaccaacgctaactggggt
gacttctggcttaacgagggcttcaccatgtatgcccagcgccgggtgtgcacagagatt
tatggagaggcctacgctagtctggaggctgcaactgggagagcgttacttagacagcac
atggacaacaccggagaggaccaccctctaaacaaactgcgtgtcaagatcaaaccaggt
gttgatcctgatgacacatataatgagacgccttatgagaagggcttctgttttgtctcc
tacctggcccacctggctggagagcagagtcgctttgacgctttccttaaggcttacatt
gacaagttcaagttccgcagtataatggcagaggatgccctggagttctaccttgaatat
ttccctgacctgaagaagaaagacgtgcacaaaattgagggtctggagtttgatacttgg
ctcaatgtgtctggttggcctccctatcttcctgacctgtcagccggccagagcctgatg
aagcctgctgagcagctctcggagctgtggggtgccgaggggctcgatatgaccagcatt
aggaagatcaacatccaggcctggaagacttaccagactgcctacttcctagagaagatc
atagagaagtctccactgcctagaggtaatatagagaaactggagggggaataccctcac
attgtgaagtcgaacaatgctgagttacgactgcgctgggcacagatcatcgccaaaaat
cagcaccagccaggatatcaacatgtgcgcaacttcctaagctgccaggggaaacagaag
tacaccctgcctgtgtaccgtgcactatggaatggatcagaggagacgagggctctggcc
acggagatcttcaatgccacttcccatcaactccatatcaatgtctgcaaaaatgtcaaa
aagataatcacctga

DBGET integrated database retrieval system