KEGG   Esox lucius (northern pike): 105016942
Entry
105016942         CDS       T04894                                 

Gene name
npepl1
Definition
(RefSeq) probable aminopeptidase NPEPL1
  KO
K09611  probable aminopeptidase NPEPL1 [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105016942 (npepl1)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105016942 (npepl1)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   105016942 (npepl1)
SSDB
Motif
Pfam: Peptidase_M17 Pdase_M17_N2
Other DBs
NCBI-GeneID: 105016942
NCBI-ProteinID: XP_010879442
AA seq 525 aa
MANVVLEFKASAGDSEPQNRPVLIVGQLNNLQKVNWSQVKGKLQSAVSEKVWQAALSALN
PNPTDSCPLYLSHAAVAALPSRVSRHNSPSSAHFLSRLVRTCLPGGTNRCILIVCERSDV
FASACAVARAFPIFSRRSATSRRTETKQVTVEFMVVGQDNGPLDPNTLMCLVNAADGVRL
AARIVDTPCNEMNTDHFLEEIKTVGSELGITPVIIRGDELKQKGFGGIYGVGKAAVNPPA
LAVLSHKPDGATQTIAWVGKGIVYDTGGLSIKGKTNMPGMKRDCGGAAAILGAFKATVKQ
GFKDNLHAVFCLAENAVGPTATRPDDIHTLYSGKTVEINNTDAEGRLVLSDGVVYASKDL
SADVILDMATLTGAQGISTGKYHCAVMTNSEQWEMACVKAGRSSGDLAHPLVYCPELHFS
EFTSAVADMKNSVADRENATSSCAGLFIGSHLGFDWPGVWVHVDIASPVHAGERATGFGV
ALLLALFGQASEDPMLNQVSPLGAGTVNAVSGEPMGHDCKRRRLV
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcgaacgtggtgctcgagttcaaggcttctgccggagactcggagccccaaaatcgc
ccggtattgattgtcggtcaactgaataacctgcagaaagttaactggtctcaagtcaag
ggaaaattgcagtcagctgtcagtgaaaaggtctggcaggctgccctcagtgctctaaac
cctaaccctacagatagttgccctctgtacttgagtcatgcagctgttgcagcgttgccc
tcccgggttagcagacacaacagcccctcctctgcccacttcctctcccgtctggtccgc
acctgcttgcctggagggacgaaccgctgcattctgatagtgtgtgagcggtcagatgtg
tttgcctcggcctgtgctgtcgcccgggccttccccatattctcccgtcgctctgccacc
tcccgcagaaccgagactaagcaagtcactgtggagtttatggtcgtgggccaagacaat
ggacctctggaccccaatacactgatgtgtcttgttaatgctgcggatggagtgagactg
gctgcacggattgtggacacaccgtgtaacgagatgaacacggatcacttcttggaggag
attaagactgtgggatctgaactcggcattactcctgttataattcgtggtgatgaactg
aagcagaagggatttggagggatctatggagtgggcaaagcagcagtgaacccccctgct
ctggcagtcttgagtcacaaaccagatggcgccacccagactattgcatgggtgggcaag
ggcatcgtttatgacactggcggcctcagcatcaagggaaagacaaacatgcctgggatg
aagagagactgtggtggggcagcagccatcttaggtgcttttaaagctacagtgaaacag
ggcttcaaagacaatctgcatgccgttttctgcctggctgagaatgcagttggacccact
gcaacacggccagatgatatccacactctgtactctggaaagacagtggagatcaacaac
actgatgctgagggaaggctggtgctgtctgatggtgtggtctatgccagcaaggacctc
tctgcagacgtcatcctggatatggccactctgacaggtgcacaggggatctccacaggg
aagtaccattgtgctgtgatgaccaacagtgagcagtgggagatggcgtgtgtgaaggcc
ggccgcagcagtggagacctggctcaccccctggtgtactgcccagagctgcacttcagc
gagttcacctcagctgtggcggacatgaagaactcagtggctgaccgggagaacgccaca
agctcctgtgcaggcctcttcattggatcccacctgggctttgactggcctggagtctgg
gtccatgtggacatagcctcccctgtccatgctggggaacgtgctaccggctttggtgtg
gctctgctcctggcactgtttggccaggcctcagaagaccctatgctcaaccaggtctct
cccctgggggcgggtacggtgaatgctgtgtccggggagccgatggggcatgactgcaag
agaaggagactggtgtaa

DBGET integrated database retrieval system