KEGG   Esox lucius (northern pike): 105016948
Entry
105016948         CDS       T04894                                 

Gene name
ctdsp2
Definition
(RefSeq) carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105016948 (ctdsp2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105016948 (ctdsp2)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105016948 (ctdsp2)
Protein phosphatases and associated proteins [BR:els01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   105016948 (ctdsp2)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105016948 (ctdsp2)
SSDB
Motif
Pfam: NIF
Other DBs
NCBI-GeneID: 105016948
NCBI-ProteinID: XP_010879454
UniProt: A0A3P9AHN5
AA seq 258 aa
MESSIITQVQKEDSQLPSKTGQVKQSSPKKPRSRNIFKALFCCLRAQDAPQAPPPSQDTL
LTPEDNGTVAKVPGTSLLPEVTPQDAGKICVVIDLDETLVHSSFKPISNADFIVPVEIEG
TTHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVTDLLDKCGVFQTRLFRESCV
FHQGCYVKDLSRLGRQLNRTLILDNSPASYIFHPENAVPVVSWFDDLEDTELLSLLPIFE
ELSEAQDVYDKLQQLRAP
NT seq 777 nt   +upstreamnt  +downstreamnt
atggaaagttctattattactcaagtgcagaaagaagatagtcaactgccgtccaaaaca
ggccaggtgaaacaatcttccccaaagaagcctcggagccggaatatcttcaaagccctc
ttctgttgcctccgagcacaggatgcacctcaggctccacccccttcccaggataccctt
ctcactcctgaggacaatgggacggttgccaaggttccagggaccagtttactgcctgag
gtaacccctcaggacgcgggcaagatctgtgtggtcattgacctggacgagacgctggtg
cacagttccttcaagccaatcagtaatgctgacttcattgtacctgtggagattgaagga
acaacgcaccaggtttacgtcctgaagaggcctcatgtagatgagttcctccagaggatg
ggagagctgttcgagtgtgttctcttcactgctagtctcgccaagtatgccgacccagtg
accgacctgcttgacaagtgcggggtgttccagacgcgtcttttccgggagtcctgtgtg
tttcaccagggctgctacgtcaaggacctgagccgcctgggccgccagctcaacaggacc
ctcatcctggacaactcccctgcctcctacatcttccaccctgagaacgctgtgcctgtg
gtgtcctggtttgacgacctggaggacactgagctgctgagcctcctgcccatctttgag
gagctgagtgaggcgcaggacgtctatgacaaactgcagcaactgcgagccccttga

DBGET integrated database retrieval system