KEGG   Esox lucius (northern pike): 105017847Help
Entry
105017847         CDS       T04894                                 

Gene name
nt5e
Definition
(RefSeq) 5'-nucleotidase isoform X1
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els00240  Pyrimidine metabolism
els00760  Nicotinate and nicotinamide metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105017847 (nt5e)
   00240 Pyrimidine metabolism
    105017847 (nt5e)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    105017847 (nt5e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:els04090]
    105017847 (nt5e)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:els00537]
    105017847 (nt5e)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     105017847 (nt5e)
CD molecules [BR:els04090]
 Proteins
  105017847 (nt5e)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:els00537]
 Enzymes
  105017847 (nt5e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-GeneID: 105017847
NCBI-ProteinID: XP_010881087
UniProt: A0A3P9A7Y0
AA seq 572 aa AA seqDB search
MGVRETVKAVLFSLYICHVFGGGAWELTLLHTNDVHARVEETSVDSGKCTNGDCFAGVAR
RFTKIQEIRSREKNVMLLDAGDQYQGTVWFNVYKGAEAAYFMNKLGYDAMALGNHEFDNG
VKGLIKPFLQEVNFTILSANIKADKNLAPQISGLYLPYKIFNISSERVGVVGYTSKETPA
LSQTGPNLVFEDEIDALQPQVNKLLTLGVNKIIALGHSGFKTDKEIAKRVKGVDVVIGGH
SNTFLYTGKKPSSEIPAGPYPVIVKSEDGRKVPVVQAFAFGKYLGYLKVTFDESGNVHQS
TGNPILLNSSIPQDPQILAEVNEWKKALANYSNQYVGRTLVYLNGTFEECRFRECNLGNL
ICDAMVHHNVKYPDELKWNHVSCCILQGGGIRSSVDERSRNGSIMMEDLISVMPFGGTFD
LVLLKGSTLRKVFEHSVKRYGQNTGEFLQVSGFHVEYDMSRPPENRATSISVLCTDCRVP
HYEPLDDNKEYKVVMPSYLAEGGDGYSMIKNGKLKHDTGDMDIAVLQRYITERKKVHPAV
EGRIKIFNSASGPRHMSLLILLGFLMALSGSQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcgtgagacagtcaaggcagttttattctctctctacatctgtcatgttttt
ggtgggggtgcgtgggaactcaccctgcttcataccaacgatgtccacgcaagagtcgaa
gagacaagcgtggactctggcaaatgcacaaatggtgattgttttgctggagtggcaaga
agatttacgaaaatacaggagatccgaagccgggagaaaaatgtgatgctgctagacgca
ggcgatcaatatcaaggaactgtttggtttaacgtctataaaggagccgaggctgcatat
tttatgaataaacttggatacgatgcaatggccctgggaaatcatgagtttgacaatggc
gtaaagggactaatcaagccatttctccaggaggtgaatttcacaatcctcagtgctaac
atcaaagctgacaagaacctagccccgcagataagtggcctttatttgccgtataagata
tttaatatcagctctgagcgagtgggcgtggtgggatacacatcaaaggagacacctgct
ctctcacagacagggccgaatttagtgtttgaagatgagattgatgccctccagccccag
gtcaacaaactcctcactttgggggtcaacaagataatcgcccttggtcactctggcttc
aaaacagacaaagaaatagccaaaagggtaaagggagtggatgtggtcatcgggggacac
agtaacacttttctgtatacaggaaaaaagccttcctctgagatcccagcaggtccctac
cctgtcatagtaaagtcagaggacgggcggaaagttcctgtggtgcaggcttttgccttt
ggtaaatatctgggttacctcaaggtgacgtttgacgagtctggaaatgttcaccagtca
acaggcaaccccatcctgctaaacagctctataccacaggacccccaaattcttgctgaa
gtaaacgagtggaaaaaggccctcgcaaattactccaaccagtatgtggggaggaccctg
gtgtatcttaatggaacctttgaagagtgcaggttccgtgagtgcaacctgggtaacctt
atatgtgacgctatggtacatcacaacgttaagtatccagatgagcttaagtggaatcat
gtctcctgctgtatcctccaagggggaggtatacgctcttccgtggatgagcgcagtaga
aatggttctatcatgatggaggaccttatttcggtcatgcctttcgggggcaccttcgat
ctggttctgctgaaagggtccactctgaggaaagtttttgagcactccgtaaagagatac
ggacaaaacaccggggaattccttcaagtgtcaggattccatgtagagtacgatatgtca
cgacccccagagaaccgcgccaccagtatcagcgtcctgtgcacggactgccgagtgccc
cactatgagcctctggacgataacaaggagtacaaggtggtcatgccctcttacttagca
gaaggtggagacggatactccatgatcaaaaacgggaagctgaaacatgacaccggtgac
atggacattgcggtgttgcagcgctacattacagagagaaagaaggtgcatccagctgta
gagggacgtatcaagattttcaactccgcttcaggaccaagacacatgagcctgttgatt
ttactggggtttctgatggctttgtctgggagccaatga

DBGET integrated database retrieval system