KEGG   Esox lucius (northern pike): 105017899Help
Entry
105017899         CDS       T04894                                 

Gene name
ppil4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 4
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:els03041]
    105017899 (ppil4)
   03110 Chaperones and folding catalysts [BR:els03110]
    105017899 (ppil4)
Enzymes [BR:els01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105017899 (ppil4)
Spliceosome [BR:els03041]
 Complex C
  Other components
   PPlases
    105017899 (ppil4)
Chaperones and folding catalysts [BR:els03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    105017899 (ppil4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 Rab_bind
Motif
Other DBs
NCBI-GeneID: 105017899
NCBI-ProteinID: XP_019911768
UniProt: A0A3P8YS54
AA seq 466 aa AA seqDB search
MAVLLETTLGDIVIDLFTEERPKTSLNFLKLCKIKFYNYCLIHNVQRDFIVQTGDPTGTG
RGGESVYGILYGDQARYFDAEKNPRIKHRKKGIVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVSEGMDVLAKINETFVDKDFIPFQDIRINHTLILEDPFDDPTDLPVPERSPE
PTKEQLDSGRIGADEVIDDTVGKKAEELDELLKEKEAKTQAILLEMVGDLPDAEVKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGSIKCCEIIRDWKSGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVSKIKWKGKGGKYTKDDFKAYENHVGSKLGLKDNIKPKQDSK
YDLLLEEEGTSRQHAEKKHKDKKHYHSDEEDTRKSKKSKGDGEVPRREKKAERQRSRSRE
KDRDGRHKHSRSREKHRPEGRERSYRERSHSHSPRKSKDKDRSRHR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcttcttgaaacaacattaggtgatatcgtcattgacttatttacagaagaa
aggcctaaaacttccctaaatttcttgaagttatgcaaaatcaaattctacaactactgc
ctcattcacaatgtccagagagacttcattgtgcagactggagatcccactgggactggt
cgtggcggtgaatctgtctatggcatactctacggtgaccaggcacgctactttgatgca
gagaaaaacccacggatcaaacacagaaagaagggaattgtatccatggtgaataatggc
agtgatcagcatggttctcagttcttgatcacaactggtgaaaacctggactacctggat
ggagttcacacagttttcggagaggtgtcggagggcatggacgtcttggccaagatcaat
gagacctttgttgacaaggacttcatcccttttcaggatatcaggataaatcacactctg
atcctggaagacccttttgatgaccctacagaccttccagtgcctgagcgctcccctgaa
cctaccaaggaacagctggatagtggtcgtattggagcagacgaagtgatcgacgacaca
gtcgggaagaaggctgaggagctggatgagctgctgaaggagaaggaggccaagacccag
gccattctactggagatggtgggtgatctccctgatgcagaagtgaaacctcctgagaat
gtgctgtttgtttgtaagctgaaccccgttaccacagatgaggacctggaaatcatattc
tcccgatttggatccataaaatgctgtgagatcatcagagactggaagtctggagagtcc
ctgtgttatgctttcattgagtttgaaaaggaggaggactgtgaaaaggccttctttaag
atggacaacgtgctcatcgatgatagacgcatacacgtggacttcagccagtctgtctcc
aagatcaaatggaaaggcaaaggtggaaagtatacaaaggatgacttcaaggcctatgaa
aaccatgtgggatccaaattaggtctaaaggataacatcaaacctaagcaagactccaag
tatgacctgctactggaggaagaaggtactagccgtcagcatgctgagaagaaacacaaa
gacaaaaaacactatcactcagacgaagaggacaccaggaaatccaagaaatccaagggt
gacggtgaggttcccagacgggagaagaaggcggagcgtcagcgttctcgctcccgggaa
aaagacagagacggccgccataagcacagcagatcccgtgaaaagcatcgcccagagggc
cgggagcgcagctacagggagcggagtcacagccactcacccaggaagtccaaagacaag
gacaggagcagacatcgatga

DBGET integrated database retrieval system