KEGG   Esox lucius (northern pike): 105018699
Entry
105018699         CDS       T04894                                 

Gene name
spty2d1
Definition
(RefSeq) protein SPT2 homolog isoform X1
  KO
K15193  protein SPT2
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105018699 (spty2d1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105018699 (spty2d1)
SSDB
Motif
Pfam: SPT2
Other DBs
NCBI-GeneID: 105018699
NCBI-ProteinID: XP_010882646
UniProt: A0A3P9AKE4
AA seq 709 aa
MDFENVLSIASQNQGLSSVPKRYSLQTGPPKKDPKVKGVNSAAVQAFLKKKEMENKKKEL
LSMKKKEHLLAKRVELKSDRKARAMASRTKDNFRGYNGIPVVDEPKKRRSRGDREEEQHQ
NNTYDEDYEDNYEYAQTDSETEPDPEGPRQTAPSSSPKPPKRPGGPLKPAPPPMNFTELL
KLAQKKQFEPVEVKAKPSKKGEPERLRTADEIRELELERKAKKLGKGGKDYRPSEREHNR
DKHKDRERGNKSQASFSSSRKSTSDRDINNGKQPLRSSLERPFSGGQSKKTKPVLPPSKL
SERSQHCSSKPSQDRDRPKTSLISSSSSSGALSSKAPAKGASSQISAKNLTQRPSSAGQK
TTATSDLNPPRKGNLSLPPSRPSNSGVRTSAAPHSAQARPQGSGQSRPACSGQARPGHGS
SGRPGNTGGTPRPGNGETVRPGGNSSARPGNNGQMRPTSVGPSRPGGPPQARLGGPPQAR
LGGPPQARLGGPPQARLGGPPQARPGGPPQARPGSGSSQGRPGGGAIRPGAGGPMAGRPA
SGVGSGPGRPKCSVVAETISSKTFGGARGGPHNPGMPLNRPGMPPRPGMQPRPIMRPPGT
MLPPITSAYKRKYEEEEEYDSEMEDFIDDEGEPQDEISKHIREIFGYDRTKYKEESDYAL
KFMESSWRDQQKEEARSLRLGIKEDEDEMRLEEEEMKKKMAMNAKRKKV
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggacttcgaaaatgtcctctccatcgcctctcaaaaccagggcctcagtagcgtaccg
aagcggtatagcttacaaactggaccaccaaaaaaggaccctaaagtgaaaggtgtcaac
tctgcagccgtccaggctttcttgaagaaaaaagagatggagaataaaaagaaagagctc
ctgagtatgaagaagaaagagcaccttctcgctaaaagggttgagttaaagtctgaccgc
aaggctcgagcaatggcttctcggaccaaggacaactttcggggctacaacggcatccct
gtggtggatgaaccgaagaagaggagatcacggggagatagggaagaagagcagcatcaa
aataacacttatgatgaagactacgaggataactatgaatatgcgcagacagactctgag
acagaaccggaccccgaaggacccagacagacggctcccagctccagtcccaaaccccca
aagagaccaggcggaccacttaaacctgcccctccacccatgaactttaccgagctgctc
aaactggctcagaagaagcagtttgagccggtggaggtgaaagctaagccaagcaagaaa
ggcgagccggagaggctgcggacggctgacgagatacgggagctggagttggaacgcaag
gccaagaaactgggtaaaggtggcaaagactacaggccctcagagagagagcataatagg
gacaaacataaggacagagaaagaggcaataaatcccaggccagctttagttcctcgagg
aaaagcacatccgaccgagacataaacaatgggaagcagccactcagaagctcgttggag
aggccgttctccggtgggcagagcaaaaaaacaaagcctgttctgccaccctccaagttg
agcgagagaagtcagcattgttcatctaagccgtctcaggacagagaccgacccaaaaca
tctctcatctcctcttccagctcgtcaggtgccttaagcagcaaagcccccgccaaggga
gcctcctctcagatctcagccaaaaatctgacccagcggccatcctcggcaggccagaaa
actactgccacaagtgaccttaaccctccccgaaaggggaacctttcattgcctccatcg
agacccagcaactctggggtgagaacaagcgcagctccgcattccgcccaggcaagacca
caggggtcgggtcaaagcagacccgcctgctctggtcaggcacgacctggccatggcagc
tctggaaggccaggaaacaccggaggcacccctaggcctggaaatggagaaacggtgcga
ccaggtggaaactcttcagcaaggccggggaataacgggcaaatgagacctacatcggta
ggtccttccagaccggggggcccccctcaagccagattggggggcccccctcaagccaga
ttggggggcccccctcaagccagattggggggcccccctcaagccagattggggggcccc
cctcaagccagaccggggggccctcctcaagccagaccaggcagtggtagctcccaagga
cgccccggaggaggagcgattagacctggtgctgggggacccatggctgggcggccagcc
agtggtgtaggctccgggccagggagacctaagtgcagtgtggttgctgaaaccatctcc
tcaaagacctttggtggagccaggggagggccgcacaatccaggcatgccacttaatagg
ccagggatgcctcccagacctggcatgcagcccagaccaattatgagaccaccaggcaca
atgcttccaccaatcacctcagcctacaagaggaagtacgaggaagaggaagagtatgac
tcagagatggaggacttcattgatgatgaaggggagccgcaagatgaaatctccaaacat
atcagggaaatctttggctatgatcggaccaaatacaaagaggaaagtgactatgcatta
aagttcatggaaagcagttggagagaccagcaaaaagaagaggccaggagtttacgcctg
ggaatcaaggaggatgaggatgaaatgcgcttggaggaagaagagatgaaaaagaaaatg
gcaatgaatgcaaagcggaaaaaagtatag

DBGET integrated database retrieval system