KEGG   Esox lucius (northern pike): 105019085Help
Entry
105019085         CDS       T04894                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04260  Cardiac muscle contraction
els04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105019085
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105019085
   04261 Adrenergic signaling in cardiomyocytes
    105019085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105019085
Ion channels [BR:els04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105019085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 L_HMGIC_fpl SUR7 DUF202
Motif
Other DBs
NCBI-GeneID: 105019085
NCBI-ProteinID: XP_019896583
AA seq 341 aa AA seqDB search
MSSCSSRALTILSTVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQSLEVKMALHSGLWR
VCFVAGAENGRCVASEYFTEPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFHYHYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEEMYRPHPALYRPRLSDSSDYSGRFLQPETWPPP
KRGRSDSRASSDISIQLNQTPPQPPKNNPQQSNQGGGMVPGMGPGSGSSSGASYQLPPPS
GAYNTHTLQHQHSHGNSQAMPPVAVPPPHYHTHMHMGASPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttgcagcagcagagcgctaaccatcctgtccacagtgtttggggcgtgtggc
ctgctgctggtcggtgtggccgtgtccacagactactggctgctgatggaggaaggcatt
gtgctgcagcagaaccagagcctggaggtcaaaatggccctgcactccggcctctggagg
gtctgcttcgtggctggggcagagaatgggaggtgtgtggcttcagagtatttcactgag
ccagagatagaaatcaccacagagaacactgccaatatcctgaaaatggtgcggacggcc
actccgtttcccatggtgtctttgctcttcgtctttaccgccttcgtcatcagtaacatc
ggacacatccgtccccagcgcaccatcctggccttcgtctctgggatcttcttcatcctc
tcaggcctcagtctggtggtgggcctggtcctctacatctccagtattaatgatgaggtg
atgaacagaccgagggaacctgaacagttcttccactaccactacggctggtccttcgcc
tttgcggcctcctcgttcctactcaaagagggggctggggtgatgtcagtctatctgttt
atgaagcgttatgctgaggaggagatgtatcgcccccaccccgccctctaccgccctcgt
ttgtctgacagcagtgactacagtggccgatttcttcaacctgagacctggcctcctccc
aagaggggccgaagcgactcccgggcctccagcgacatctccatccagctcaaccaaacc
cccccgcagccccccaaaaacaacccccagcagagcaaccaaggtggaggcatggtgcca
ggcatgggccctggatctgggtcctcatccggagctagctaccagctgcccccaccatct
ggggcatacaacacccacacactccagcaccaacactctcatggaaactcccaggccatg
ccccccgttgccgtgccccctcctcactaccacacacacatgcacatgggggcctccccc
tgttag

DBGET integrated database retrieval system