KEGG   Esox lucius (northern pike): 105019107Help
Entry
105019107         CDS       T04894                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
els  Esox lucius (northern pike)
Pathway
els03040  Spliceosome
els04010  MAPK signaling pathway
els04141  Protein processing in endoplasmic reticulum
els04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105019107
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105019107
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105019107
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105019107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105019107
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:els03041]
    105019107
   03009 Ribosome biogenesis [BR:els03009]
    105019107
   03110 Chaperones and folding catalysts [BR:els03110]
    105019107
   04131 Membrane trafficking [BR:els04131]
    105019107
   03051 Proteasome [BR:els03051]
    105019107
   03029 Mitochondrial biogenesis [BR:els03029]
    105019107
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105019107
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105019107
Spliceosome [BR:els03041]
 Complex B
  Other components
   Prp19 complex
    105019107
 Complex C
   Prp19-CDC5 complex
    105019107
Ribosome biogenesis [BR:els03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105019107
Chaperones and folding catalysts [BR:els03110]
 Heat shock proteins
  HSP70 / DNAK
   105019107
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105019107
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105019107
Proteasome [BR:els03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105019107
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105019107
Exosome [BR:els04147]
 Exosomal proteins
  Proteins found in most exosomes
   105019107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR DUF1464 CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 105019107
NCBI-ProteinID: XP_010883327
AA seq 651 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFVVVNDGGKPKMEVEYKGEKKTFFPEEVS
SMVLTKMKEISEAYLGKAVNNAVITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAA
IAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIGEFKRKFKKDISGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRA
RFEELNADLFRGTLDPVEKSMRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDLFNGRDLN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQVEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLTKEDIERMVQEADQYKAEDEAQKEKVTAKN
SLESLAFNMKSTVDDEKLAEKISPEDKKTIVDKCNEVISWLDRNQTAEKDEYDYQQKELE
KICNPIITKLYQGGAGPQGGMPGGMPGGMPGGFPGGPGGSSSSGPTIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggacccgcagtgggcattgacctgggcaccacatactcctgtgtgggcatc
ttccaacatggcaaagtggagatcattgctaacgaccagggcaacaggactacacccagt
tatgtggccttcactgacacagagaggcttattggtgacgctgccaagaaccaggttgcc
atgaacccaaccaacactgtttttgatgccaagcgtctgattggtcgtaggttcgacgac
tccgtggtgcagtcggacatgaagcactggccctttgttgtggtgaatgatggtggtaaa
cccaaaatggaggtggagtacaaaggagaaaagaagacctttttcccagaggaggtgtct
tccatggtgctcactaagatgaaagagatctctgaagcctacctaggaaaggcagtaaac
aacgctgtcatcacagtccccgcctactttaatgactcccaacgccaagcaaccaaagat
gctggtgtgattgctggactcaacgtaatgcgtatcatcaatgagcccaccgctgcagcc
attgcatatggcctggacaaaaaggtgggcagtgagcgaaatgttctgatctttgacctg
ggtggcggcactttcgacgtatccatcctgactattgaggacggcatctttgaggtcaag
tccaccgctggcgacacccacctgggaggcgaggactttgacaaccgcatggtcaaccac
ttcattggcgagttcaagcgcaaattcaagaaggacatcagtggcaacaagcgagcggta
cggcgcctgcgcactgcctgtgagcgtgccaaacgcaccctctcctccagcacccaggca
agcattgagatcgattccctgtatgagggggccgacttctacacctccatcactagggct
cgcttcgaggagctcaatgctgacctgttccgtggcacattggatcctgtggaaaagtcc
atgagagatgctaagatggacaaggcccaaattcatgacatcgtcctggtgggaggctcc
acacgaatccccaagatccagaagcttctgcaggacttattcaatggccgagacctaaac
aagagcatcaaccccgatgaggctgtggcttatggcgctgctgtccaggctgccatcttg
gctggtgacaagtcagagaatgtgcaggatctattgctgttggatgttacacccctgtct
ctgggtattgagactgctggaggagtcatgacagtcctcatcaagaggaataccaccatc
cccaccaagcagacccagaccttcaccacatattcagacaatcagcctggagttctcatc
caggtgtatgagggggaaagagcaatgaccaaggacaacaatatcctaggcaagtttgag
ctgactggaatccctccggcccccaggggtgtcccccaggtcgaggtgacgtttgacatt
gacgccaacggtatcctcaatgtgtctgcagtggacaagagcactggcaaggagaataag
ataaccatcaccaatgacaaaggacgtctaactaaggaagacattgagcgcatggtgcag
gaagcagaccaatacaaggctgaggatgaggctcagaaagagaaggtaacagctaagaat
tccttggagtccctggccttcaacatgaaaagcactgtggacgatgagaagcttgcagaa
aagatcagcccagaggacaagaagaccattgtggacaagtgcaatgaagtaatctcctgg
ctggacagaaaccagacagcagagaaggatgagtacgactaccaacagaaagagctggag
aaaatatgtaaccccatcatcaccaagctataccagggtggtgcaggcccacaaggtggt
atgccaggaggtatgcctggaggtatgcccggcggcttccctggagggcctggtggcagt
tcatcttctggtccaactattgaggaagttgactaa

DBGET integrated database retrieval system