KEGG   Esox lucius (northern pike): 105019452
Entry
105019452         CDS       T04894                                 

Definition
(RefSeq) uncharacterized protein LOC105019452
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105019452
Transcription factors [BR:els03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    105019452
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 105019452
NCBI-ProteinID: XP_010883969
UniProt: A0A3P8ZC38
AA seq 690 aa
MIPPGDCMYAGRKRRKPIQKQKPATVSEKSNPSKRHRDRLNAELDRLASMLPFSPDIISK
LDKLSVLRLSVSYLRVKSFFTVNHEKPSSKKHLSPPTNSGPEPRKDNLHMVMGSNVTESG
LLLESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHW
AMNPSHQGSSQDHDSSAGTGEDFLVNSLFHSQEAGGVAPEFSSFLNRCFISRVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSGSGALLPSQLALFCVAVPLLLPSITEMKIKSLMMKGKH
KSGGGNVSAIEHGEREEHFRRHTSSVGLVDGGDPLALNCTNPAGPQQRHHTPWTPLSKDS
LKFKTEGGYYSQDEPLNYCKTSMGGPPHHKSPGLDTSWPMRPASGPIRTGQSGGYIPSSR
LGKAGHYGKPYRMSPGMCHGGGRSGEVYVPKMYSSLQSPDASDLYCVGEALKSENGYVEC
YDGRLLPEMPIKVEQDSDSENGCDAYGRPWACRETLDRRYGYGENNVLQMKSEADYYEHY
SPCQRGKAGMSPVSPAYNNGHYQNYNHTVGGRPMKCVIHKDQSQYSPQRLSHSDPLCSSQ
SINCMDGYAGSPVEHVKGYMQQDYKLGYEFKGHGLLHTIKREPMDSPPWSGGGGGGHEMS
HAMGHSQRNAMPNCIANSGHHKVNPYVYMQ
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgataccacccggagactgcatgtatgcgggcaggaaaagaaggaagcccattcaaaaa
caaaaaccagcaacagtgagtgagaagtccaacccatccaagaggcaccgggaccgcctg
aatgcagaactggatcggctggcgagtatgctgcctttctccccagacatcatctccaag
ctggacaagctgtcagtgctgcgcctcagcgtcagctatcttcgtgtcaagagcttcttt
acagtaaatcacgagaagccatccagcaaaaaacacctaagtccacccaccaactctggc
ccagagcccagaaaggacaacctgcatatggtcatgggcagcaacgtcacagagagcggg
cttctcctggagtccctcactggctttgcattggtggtgagcagtgacgggatggtcttc
tatgcctcttccaccatcgttgactacttgggattccatcagacagacgtgatgcaccag
aacgtctttgactacatccatgtggacgaccggcaggagttcagaagacagctccattgg
gccatgaaccccagccatcaaggctcatcccaggaccatgactcatcagcaggaactggc
gaggactttctggtgaacagccttttccattctcaggaagcaggcggagttgctcctgag
ttctcctctttcctcaaccgctgtttcatctcccgtgttcgctgccttctggacagtacc
tccggcttcctgaccatgcagttccaggggcgtctcaagttcctccacggccagaagaag
aagtctggttcaggggccctgctaccctcccagctggccctgttctgtgtggccgtgccc
cttctgttgccctccatcacagagatgaagataaagagcctgatgatgaagggcaagcac
aagagtggagggggcaacgtcagcgcaatagaacatggggagagagaggagcacttcagg
aggcacacgagcagtgttggactggtggacggtggggacccgttggccctcaactgcacc
aaccctgccgggccccaacagcgccaccacaccccttggacacccctctccaaagacagc
ctgaaatttaagacggaggggggctactacagccaggacgaacccctcaactactgcaag
acctccatgggtggcccccctcaccacaaaagcccaggcctggacacctcgtggcctatg
cgtcctgcctccgggcccatccggacgggccagagtggtggctacatcccctccagtaga
ctcggaaaggcaggccactacggcaaaccctaccgcatgtcccctggcatgtgtcatggg
ggagggcggagtggcgaggtctacgtgcccaagatgtacagcagcctgcaaagccccgac
gcctccgatctgtactgcgtgggcgaggcgctgaagagcgagaacgggtacgtcgagtgc
tacgacgggcgcctgctgcccgagatgcccatcaaggtggagcaggactcggactcggag
aacggctgcgacgcctacggccgtccgtgggcgtgccgggagacgctagaccgccgttac
ggctacggcgaaaacaatgtcctccagatgaagtcggaggcggactactacgagcattat
tcgccatgccagcgtggcaaggctggcatgagtcccgtcagcccggcgtacaacaacggg
cactaccagaactataaccacacggtgggcggaaggcccatgaagtgtgtgatccacaag
gaccagtctcagtacagcccccagcggctgtcccactcagaccccctctgtagcagtcag
agcatcaactgcatggacgggtatgccggcagccctgtggagcacgtcaagggctacatg
caacaggactacaaacttggctacgagttcaaaggtcacggactactccacactatcaag
cgggagcccatggactcgcccccatggtcgggcggcggcggcggtggccatgaaatgagc
catgccatggggcactctcagaggaacgctatgcccaattgtatagcaaactctgggcat
cacaaagtcaacccatatgtttatatgcaatag

DBGET integrated database retrieval system