KEGG   Esox lucius (northern pike): 105019804Help
Entry
105019804         CDS       T04894                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
els  Esox lucius (northern pike)
Pathway
els00120  Primary bile acid biosynthesis
els01100  Metabolic pathways
els03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    105019804
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105019804
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:els00199]
    105019804
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     105019804
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     105019804
Cytochrome P450 [BR:els00199]
 Cytochrome P450, animal type
  CYP8 family
   105019804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 105019804
NCBI-ProteinID: XP_012995756
UniProt: A0A3P8Z5C1
AA seq 512 aa AA seqDB search
MGFLLPILIALLASVLGGLYLLGAFRQRRPGEPPLDRGPLPWLGHVLEFRRDTAKFLERM
KRKHGDIFTVQLGGYYFTFLMDPLSFGTVVKEPRTNLDFTKFAAQLVKKVFSYHSMDVDH
KFLQASSNKHLMGDGLVVLTQAMMTNLQNLMLQSTETRENNQKTWNEDGLFHYSYNIVFR
AGYLSLFGNETPKSTESLEKAIDIDRKKSQELFYEFRKYDQLFPRLAYGVLPPGKKREAE
RLKRLFWNMLSVHKLKTRENVSGWVREQQQEREEHGMEEFMQDRYMFLLLWASQGNTGPA
AFWLLLYLMKHPDAMRAVQQEAEKVLKETGQEVKHGGPLVDLTRDMLLKTPILDSAVEET
LRLTVAPVLTRAVLKDMSLKLADGNEYWLREGDRVAMFPYTAVQMDPDVHQDPLTFKYDR
FLTADGAKKTDFYTGGIKLKYYNMPWGAGHTMCPGRFFATNELKQFVFLVLIYFDFELKN
PDEKIPDIDVTRWGFGSMQPTKDVQFKYRLKF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctgctgccgatacttattgccctgctagcctctgtcctgggtgggctttat
ctcctgggggccttcagacagcgtcgtcctggggaaccccccctggaccgaggccccctt
ccctggcttggacacgtcctagagtttcgcagagacacagcaaagtttctggagaggatg
aagagaaagcatggggatattttcactgtgcaactgggaggatattactttacattcctc
atggacccgctgtccttcgggacagttgtgaaggagccccgaacaaacctggacttcacc
aagtttgcagcgcagctagtgaaaaaagtgttcagctaccactccatggatgtagaccac
aagtttctacaggcctccagcaacaagcatctgatgggggacggtttagtggtcttgacc
caagccatgatgaccaacttacagaatctgatgctgcagagcacagaaactagagaaaat
aaccaaaagacctggaatgaggacggtctgtttcactacagctacaacattgtcttcagg
gcaggttacctgtctctgttcggtaatgagacacctaaatctacagagagtctggaaaaa
gcaatagacattgacagaaagaagtctcaagagctcttctatgagtttcgtaagtacgat
caactcttccccagactggcatatggggtcctgcctccagggaagaaaagagaggcagag
aggcttaaaaggttgttctggaacatgctgtcagtacataaattgaagaccagggaaaat
gtcagcggctgggtacgtgagcagcagcaggagcgggaggagcacggcatggaagaattc
atgcaggacagatacatgttccttctcctctgggcctcacagggcaacacaggccctgct
gccttctggctccttctctatctcatgaagcacccggacgccatgagggctgtgcagcag
gaggcggagaaagtcctgaaggagacaggccaggaggtgaagcatggcggcccattagtt
gacctgaccagagacatgctgctaaagacgcccatcctggacagtgccgtggaagagacc
ctccgcctcactgtcgcccctgtcctcaccagggccgtactcaaggacatgtcactcaag
ctggctgatggaaatgagtactggctcagagaaggagacagagtagccatgtttccctat
actgccgttcagatggatccggatgtccaccaagacccactcacattcaagtatgatcgc
ttcctgaccgcagacggggcaaagaaaacagatttttacacaggtggaataaaactgaag
tactacaatatgccgtggggtgctggacacaccatgtgccccgggcgcttctttgccact
aatgagctgaaacagtttgtctttctcgtgctcatatattttgactttgagctcaaaaac
ccagatgaaaagattcctgatattgacgtcacacgttggggttttgggtccatgcagcca
actaaagatgtccagtttaagtacagactcaagttttaa

DBGET integrated database retrieval system