KEGG   Esox lucius (northern pike): 105020187
Entry
105020187         CDS       T04894                                 

Gene name
lta4h
Definition
(RefSeq) leukotriene A-4 hydrolase
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
els  Esox lucius (northern pike)
Pathway
els00590  Arachidonic acid metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105020187 (lta4h)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105020187 (lta4h)
Enzymes [BR:els01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     105020187 (lta4h)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105020187 (lta4h)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 105020187
NCBI-ProteinID: XP_012995574
UniProt: A0A3P8Y6G9
AA seq 617 aa
MASTTDPCSFSSFSKCVTKHLNLNYHVDFDSHVLKSKVALTVEVLEDNFTTLTLDTKDLK
VAEVTANGQAAKFTLGPKHSFKGTPLEITLPFELSRGQHVIVEVTYETAPNASALQWLTP
EQTAGKKHPYLFSQCQANHCRSLIPCQDTPSVKHTYYAQVSVPKELVAVMSAVRDGQKPD
PQDNGRVIYHFRQPVPMPSYLIAIVVGALESRAIGPRSHVWSEKEFVDKAAFEFSETEVM
LTTAEDLAGPYVWGQYDILVLPPSFPYGGMENPCLTFATPTLLAGDRSLSNVIAHEISHS
WTGNLVTNKTWEHFWLNEGHTVYLERMIGRSMESEKFRQFKALGGWKELQESVNTFGANN
PLTNLVPDLTDVDPDDSFSSVPYEKGFALLYHLEELMGGPEIFMGFVKSYIQRYAYSSVT
TEEWKAYLFTYFKEKVDILNNVDWTAWMYTPGMPPVKPQYDTTLADACIALCKRWLKATE
GDLGCFSEADVKTLSTHQLIEFLSLLLQEEPLPLSHVKRMQEVYNLNSLQNSEIRFRWLR
LCVRSKWEDAVVMALKMATEQGRMKFTRPLFREVYNFEKYREKAVCVFKARRAAMHPVTA
SLVAKDLKVDDSQSTGL
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggcttcaactactgacccttgctcattttcatccttctctaaatgcgttaccaagcac
ctgaatctcaattatcatgtggattttgacagccatgtccttaaatctaaggtcgcgctc
actgtggaggttctcgaggacaatttcacgactttgacccttgatacaaaggacctgaag
gtggcggaagtaacagccaatggacaggcagcaaagttcaccctaggtcccaagcacagc
ttcaaggggacccctctggagatcacactgccctttgagctctctaggggtcagcatgtg
attgtggaggtgacctatgagacggctcctaatgcttctgcgctgcaatggctcactcca
gaacagacagcagggaagaaacatccctacctcttcagccagtgccaggccaaccactgc
aggagcctgataccctgccaggacaccccatctgtcaagcacacctactatgcccaggtg
tctgtccccaaggaactggtggcagtgatgagtgctgtacgagacggacagaaacccgac
ccccaggacaacggcagggtcatctaccacttcagacagccagtacccatgccctcatac
ctcattgccatcgtagtgggagctctggagagcagagcgattgggcccagatctcatgtt
tggtcagagaaagagtttgtggacaaggccgcattcgagttctcagagaccgaggtcatg
ctgacgacagctgaggacctagcgggcccctacgtttggggccagtacgacatcctggtc
ttgcccccttccttcccatatggaggcatggagaacccctgcctcacctttgccaccccc
acactgctggccggagacaggtcattgtccaatgttatagcccatgagatctctcacagc
tggaccggcaacctggtaaccaacaagacctgggagcacttctggctcaacgagggtcac
acggtgtacctggagagaatgatcggcaggtctatggagagtgaaaagttcagacagttc
aaagccttgggtggctggaaggaactgcaggaatcggtgaatacgtttggggccaacaac
cctctgactaacctggttcccgacctcaccgacgtggacccagacgactccttctcctct
gtcccctacgagaagggcttcgctctgctctaccacctggaggagctcatgggaggacct
gagatcttcatggggttcgtcaagtcatacatccagaggtatgcttacagcagtgtcacc
acagaggagtggaaggcctacctcttcacctacttcaaggagaaggtagacatcctgaat
aatgtggactggactgcctggatgtacaccccaggcatgccccctgtaaaaccacagtac
gacaccaccttggcagatgcctgcatcgcactgtgcaagaggtggctgaaggccacagaa
ggggatctgggatgtttcagtgaggcggatgtgaagactctctccactcaccagctcata
gagttcctatccctgctcttgcaagaggagcccctccccctcagccacgtgaagaggatg
caggaagtgtacaatcttaattcgttacaaaactctgagatccgtttcaggtggctgcgg
ctttgtgtccggtccaagtgggaggatgctgtggtcatggcgctgaaaatggcaacagaa
caggggaggatgaagtttacacggccacttttcagagaggtgtataactttgaaaagtat
cgtgagaaagcagtgtgtgtgttcaaagcccgccgtgcagccatgcaccccgtcacggct
agtctggtggccaaggatctgaaggtagacgacagccaaagcaccggattgtaa

DBGET integrated database retrieval system