KEGG   Esox lucius (northern pike): 105020230
Entry
105020230         CDS       T04894                                 

Gene name
rpap3
Definition
(RefSeq) RNA polymerase II-associated protein 3
  KO
K23002  RNA polymerase II-associated protein 3
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105020230 (rpap3)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105020230 (rpap3)
SSDB
Motif
Pfam: TPR_1 RPAP3_C TPR_2 TPR_11 TPR_8 TPR_7 TPR_19 TPR_16 TPR_12 TPR_9 Fis1_TPR_C TPR_21
Other DBs
NCBI-GeneID: 105020230
NCBI-ProteinID: XP_010885380
AA seq 663 aa
MSANKAIELQLQMRQNAEDLHNFMKDLDSWETDIKKKDEELRNGIVSKSPKILPPVRNKD
YKKKREKKKALDKNAKTESKPASRIKSYDYQSWDKFDVDTALESMDKEDSAAESNDSESE
EAGVPATDRDKALAEKEKGNRLFKEGKYDNAIECYTRGMDADPYNPILPTNRAACFFRLK
KFAVAEADCNLSIALDCNYFKAFSRRGACRFALQNYVSALEDYEMVLKLDPGNVEAQNEV
KKCKEAIAKLGGEAESPDTAVVDLKQQQLMEEQRKKQEAVVQKDRGNAYFKEGKYEAAVD
CYSKGMEADSTNVLLPANRAMAYLKLLRFKEAEEDCSKAIALDGTYTKAFARRGTARSGL
GLLKEAKEDFEEVLKLEPGNKQALNELKKITSAMATRGLLATEKQSQRRTVEPINKPPHL
RSTKPLRRVEIVEVGGQDLVQEEVGGQDLVQEEQSVVFTSTTATVSRAQKTASITEINSD
VQGEASPPPSAKILKIAEISHVTGGEGDAVRAPTRKHEQATVSKPAELPVTTSTTEPEAM
PPAPTNSFQLEADFRNFRNNPEAMYKYLKQIKPQAYAKIFQSSLEPDILNQILRTLQTFY
IKNEEPSVILEILRSLASVRRFHMAIMFMSNPEKKVLLELFDCLHQAGLKDASVGALQKM
YGV
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtctgcaaacaaagccattgaactccagctgcaaatgcgacaaaatgcagaagacctg
cataacttcatgaaagatcttgacagttgggagactgacataaagaagaaggacgaggaa
ctaagaaacgggattgtcagcaaatctccaaaaatcctcccaccagtgcgaaacaaggac
tacaaaaagaagagggagaaaaagaaggcattagacaaaaatgcaaagactgaatccaag
ccagcatccagaataaagtcttatgattatcagtcgtgggataaatttgatgtggacaca
gctttggagtccatggataaagaggacagtgctgctgagtcaaatgactctgaatcagag
gaagctggagtccctgctactgatcgagacaaagcccttgctgagaaggagaaaggtaat
cggctgtttaaagaagggaagtatgataatgccattgaatgttacaccaggggaatggac
gcagacccttacaacccgattctgcctacaaacagagcagcttgcttcttcagactaaag
aagttcgctgttgctgaagctgactgcaacttatcaattgctctggactgtaactatttc
aaagctttttcaagacgaggggcgtgtcgatttgccctgcaaaattatgtatcagcccta
gaagattatgaaatggttctcaagctggatcctgggaacgtggaggcacagaatgaagtg
aagaaatgtaaagaggccattgctaaattgggtggagaagcagaaagcccagacactgct
gttgtggacctaaagcagcagcagctgatggaggaacagaggaaaaaacaggaggcagtg
gtgcagaaagaccgggggaacgcatattttaaagaagggaaatatgaggcagccgtggac
tgctacagtaagggcatggaagcggacagcaccaatgtcttgttgccggccaaccgggcc
atggcttacttaaagctactgagatttaaagaggccgaggaggactgcagtaaagccata
gccctggatgggacctacacaaaggcgtttgcccgcagagggacggccaggagcggactg
ggacttttgaaagaagctaaagaagattttgaggaggtcctgaaactggaaccaggaaac
aaacaagcattaaatgagctgaagaagatcaccagtgccatggccaccaggggtctgctg
gcgacagagaagcagtcacagcggaggacagtagagcctatcaacaaaccacctcatctg
cggtcaaccaagccattgaggagagtggaaattgtggaggtgggtgggcaggacctggtc
caggaggaggtgggtgggcaggacctggtccaggaggagcagtctgttgtgttcacttca
accactgccactgtcagtagggcccagaagacggcttccattacagaaatcaacagtgat
gtccagggtgaggcatcgccgccccctagtgctaagatcctgaaaattgcagagatttcc
cacgtcacaggtggggaaggagatgctgtcagagcaccgaccaggaagcatgaacaggcc
accgtcagcaaaccagcagaactaccagttacaacctccacaacagagcccgaggccatg
ccccctgcccccactaacagcttccaactagaggcggacttcaggaactttagaaataac
cctgaagccatgtacaagtatttgaagcaaatcaagcctcaggcgtatgccaagatcttc
cagagctctcttgaaccagacatactcaatcagattctaaggacattacaaacgttctac
atcaagaacgaagaaccctctgtcatactggaaatcctcaggagtctggccagtgtgagg
cggttccacatggccatcatgttcatgtccaacccagagaagaaagtcctactagaattg
tttgactgtcttcaccaagctggacttaaagacgcttcagttggagccctgcaaaagatg
tatggagtgtga

DBGET integrated database retrieval system