KEGG   Esox lucius (northern pike): 105020695
Entry
105020695         CDS       T04894                                 

Gene name
drap1
Definition
(RefSeq) dr1-associated corepressor
  KO
K21752  Dr1-associated corepressor
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105020695 (drap1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105020695 (drap1)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone SMN EBV-NA3
Other DBs
NCBI-GeneID: 105020695
NCBI-ProteinID: XP_010886212
AA seq 227 aa
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLTKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVAAVPDMQGEGEENHAEGGEKVARRGRKPGSGRK
NGGAGSKGKDKKLSGTESEQEDDSEDSETDGDEEDGSQSSTNLQPQSRFHSPDSMPPQYL
HMGTAQGALAMPLGSFAPHPSLIGTAAPPPPSMPHKDEDDDDEDYDS
NT seq 684 nt   +upstreamnt  +downstreamnt
atgcccagcaaaaagaagaaatacaacgccagatttccaccggcaaggattaagaagatt
atgcagactgatgaagaaataggcaaagtggctgcagcagttcctgtcatcatatcacga
gccctggagctgttcctggagtccctcctgacaaaagcctgtcaagtcacccagtcccgg
aacgccaaaaccatgacgacatcacatttaaagcaatgcattgagctggagcagcagttt
gacttcctgaaggacctggtggcggcagtgccggacatgcagggtgagggagaggagaac
cacgccgaaggaggagagaaggtggcccgcagaggtcgaaagccggggtcaggccgcaag
aatggaggagcaggctctaaaggcaaggacaagaagctatcaggaacggagtctgagcaa
gaggatgactcagaggacagcgagacagacggagatgaggaggatggttctcagtcaagc
acaaaccttcaacctcagtcacgattccacagcccagactccatgccaccccagtacctc
cacatgggcacagcacagggggctctggccatgcccctgggctcctttgccccccacccc
tcgctgattggcacggcggccccgcctccgccctctatgccgcacaaagacgaagacgac
gacgacgaagactatgactcttag

DBGET integrated database retrieval system