KEGG   Esox lucius (northern pike): 105021075Help
Entry
105021075         CDS       T04894                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1 isoform X1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els01100  Metabolic pathways
els04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105021075
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105021075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105021075
Enzymes [BR:els01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105021075
Protein kinases [BR:els01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   105021075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA EpmC
Motif
Other DBs
NCBI-GeneID: 105021075
NCBI-ProteinID: XP_010886835
AA seq 1067 aa AA seqDB search
MELLTVLALPFLLSLEPCVEGSTFTLLLSLPNTSLPFSVGRIGAGALIAIDTVNRSPNLL
AGHSLEYEYVDDECSDVNGTGKIMELWHKHNYSAFIGPACSNVCAIVSKLAAFWNVPVVS
PTCADQQFLMKKDYPTLTRVFGPFTKMGWFFVKICENFGWRRISIICDNHPAWIMPADGI
RHQAEDNNITVAKYLMIEKPLTSLTQAHTLLEITEVSRIIVISAHAEVVRSFLIEADRRG
LTTGDYIFVCFDFYNLENMFGNFNWKIGHDDDAVAKQAYGALFLLSLYKPDDQRYWNFSS
NVIRRSREDFGYVYAPDEKVSVLAAFAHDSVLLYAQALNETLAEHGDPYDGLAITQKMWN
RTIPGIQGDVTMDSCGDRESAYMMKHLQDGEFKVIANYFGTNKAYESVNEIYWPGGRKVP
PKDTPDCGFQNELCTNIERRFAVAVGTIAVLLATGTLIVCLLYRKHIIQKKVSVILWRLS
PGDVTMMDHSSTSTGKVLYINSMSIHASLESGLENTTDKPSTHRTAIYKENICSVRLLNV
KSVCLNRELLAELKRCRDLNHPNICSFIGACLEPPIFFLLTEYCPKGSLQVTHPLLCTLM
NLLSLLLQSIARAINSTATPKLQDILKNASIKLDWSFKYSLMLDIVKGMDYLHRSPLRSH
GHLSSSNCVVDSRFVLKVTDYGLSPLRRPPFQDDEGRCGSRDHWTSLLWRAPELLRDSMP
PAGTQKGDVYSFGVIVQEVVYRQGPFYIPNSTLNAHDIVERVKAGCSIRDTPLRPYTAGA
ECPEGLEALLGACWSERPSDRPDFSSLRVTVKRLCPSGMKENILDDLLSRLEQYATNLEE
VVGERTAQLVEEKRRAEGLLTQMLPRSVAGQLIAGKTVQAETYDCVTIYFSDIEGFTALS
ASLTPMQVVNMLNDLYTFFDNIIDNYNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMS
LAVVRGMRQYNSPYVPQQLLKVRIGLHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYG
SPLQIHVSSSTKALLDTFGMFCCELRGDIHMKGKGLVRTFWLLGEDQ
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggagctccttacagtgctggccctacccttccttctgtccttggagccctgtgtggaa
ggatcaacgttcacactgctcctgtccttacccaacacctccctgcccttcagtgtgggc
cggattggagcaggagccctcattgctattgacacagtgaatcggagccccaacctgtta
gcgggtcattcgctagagtatgaatatgtggatgatgagtgctctgatgtgaacggcacg
ggcaagataatggaactatggcacaaacacaactacagcgctttcatcggccctgcctgc
tctaacgtgtgcgcaatcgtgtcaaagctggcagctttctggaacgttccagtagtcagt
cccacctgtgcagaccagcaattccttatgaaaaaggattatcccactctaaccagagtg
ttcggcccctttaccaagatgggctggttctttgtgaagatctgtgagaactttggctgg
agacgtatcagcattatatgtgacaaccaccctgcctggatcatgcccgctgatggaatc
aggcaccaagctgaagacaacaacattactgtggctaaatacctgatgattgaaaaacct
ttaacttcactcacacaagcacataccttgctggagattacagaggtatctcgcatcata
gtgatctcagcacatgcagaggttgtcaggagcttcctgatcgaggctgaccgaagaggc
ctcaccacaggagattatattttcgtctgcttcgatttctacaacctggaaaacatgttt
ggcaactttaactggaaaataggacacgatgacgacgcagtggctaagcaagcttacggg
gctctgttcttactgtctctgtacaaacctgatgaccagaggtattggaacttctccagc
aacgtcatccgcaggtccagagaggacttcggttacgtctatgcacccgatgaaaaggtg
tcagtgttggcagcctttgcacacgactctgtgttgttgtatgcccaggctctgaacgaa
accttggcagaacatggtgacccatacgacggcttagccatcacccagaagatgtggaac
cggaccattccaggtatccagggtgacgttaccatggacagctgcggagacagggagtcg
gcctatatgatgaaacacctccaagacggagagttcaaagttattgccaactactttggt
acaaataaggcttatgagtctgtgaatgagatctactggccaggaggaagaaaggtgcca
ccgaaagacacaccagattgtggcttccaaaacgagctctgcaccaatatcgaaagaagg
tttgcagttgctgtagggaccattgctgttctcctggccactgggacactgatcgtttgt
cttctctacaggaagcacatcatccagaagaaggtgtctgtgatactgtggaggctcagc
ccaggtgatgtcaccatgatggatcacagctcaacctctacaggaaaggtactgtacatc
aactccatgtccatccatgcttctctggagtccggcctagaaaatacgacggacaaacct
tccacccaccgaacggcaatctataaagagaacatctgttcagtgcgactgttgaatgtg
aagagtgtctgtctgaacagagagttgcttgctgaactgaaaaggtgtagagatttgaac
cacccaaacatctgcagcttcatcggtgcttgtctggaacctccaatttttttcctgctg
acagagtattgtcctaaagggagcctgcaggtaacacacccacttctctgtacactcatg
aacctcctttcgctgcttcttcaatccatcgcaagagcaataaactctactgcaactccc
aaactccaggacattttgaagaatgcttccattaagctcgattggagcttcaagtactcc
ctgatgttggacattgtcaaggggatggactacctccaccgaagtcctctgcgttcccac
ggtcacctgtcgtcatctaactgcgtggtggacagtcgctttgtcctcaaggtgaccgac
tacggtctaagtcccctcagaagaccccctttccaggacgacgagggcaggtgtgggtcc
agagatcactggacatcgttgctgtggagggccccggagctgctgagggacagcatgcca
cccgccggcacgcagaaaggggatgtctacagttttggcgtcatcgttcaggaggttgtg
taccgccagggacctttctacatacccaacagcacgctgaatgcacacgatatagtggag
cgggtgaaggcaggctgcagcatcagagacactcctctcagaccctacacggccggggca
gagtgtccagaggggctggaggcccttctgggtgcatgctggagcgagagaccaagcgac
cgaccggatttctccagcctcagagtgaccgtgaagagactctgccccagcggcatgaag
gagaacattctggacgacttgctgtcccgcttggagcagtacgccaccaacctggaggag
gtggtcggcgagcgaaccgcccagcttgttgaggagaagaggagggccgagggcctcctc
acacagatgttgccacgatcggtggccggccagctcatcgctgggaagacggtgcaggcg
gagacctacgactgtgtcaccatctacttcagcgacatcgaggggttcaccgccctgtca
gctagtctcacgcccatgcaggtggtaaacatgctgaatgacctttatacgttctttgac
aatattatcgacaactacaatgtttacaaggtggagaccattggcgatgcttatatggta
gtgtctggcctacctattaggaacggagatgaccatgccaaggagatagctcgtatgtcg
ctcgcagtggtgcggggcatgaggcagtacaacagcccgtatgtgccacagcagctactc
aaagttcgcattggactccactcaggtccatgtgtggctggtgtggtgggactgaagatg
ccccggtactgtttgtttggagacacagtcaacactgcctcgcggatggagtcgtacggc
tcaccattgcagatccatgtaagcagctccaccaaagctctattagacacttttgggatg
ttctgctgtgagctgaggggtgacatccacatgaagggcaaagggctagtacggacgttc
tggcttttgggagaggaccagtga

DBGET integrated database retrieval system