KEGG   Esox lucius (northern pike): 105021913Help
Entry
105021913         CDS       T04894                                 

Definition
(RefSeq) aldehyde dehydrogenase family 9 member A1-B-like
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00053  Ascorbate and aldarate metabolism
els00071  Fatty acid degradation
els00280  Valine, leucine and isoleucine degradation
els00310  Lysine degradation
els00330  Arginine and proline metabolism
els00340  Histidine metabolism
els00380  Tryptophan metabolism
els00410  beta-Alanine metabolism
els00561  Glycerolipid metabolism
els00620  Pyruvate metabolism
els01100  Metabolic pathways
Module
els_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105021913
   00053 Ascorbate and aldarate metabolism
    105021913
   00620 Pyruvate metabolism
    105021913
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105021913
   00561 Glycerolipid metabolism
    105021913
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105021913
   00310 Lysine degradation
    105021913
   00330 Arginine and proline metabolism
    105021913
   00340 Histidine metabolism
    105021913
   00380 Tryptophan metabolism
    105021913
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105021913
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105021913
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     105021913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105021913
NCBI-ProteinID: XP_010888234
AA seq 526 aa AA seqDB search
MKSYNYTKMLQKQLAVVRRLRSAALLPTCIRSISSGTMDVQFPLNFWSGDRVKIKNESTS
EPVYEPATGRVLCNLESCGTVEVDQAVQAAQSAYQTWNRMSGMERARIMIEAARIIENRR
EDIAEIEVVNNGKSITEARMDVDSARLCIEYYSGLANTLAGQHVQLTGGSFAYTRREPLG
VCVGIGAWNYPFQIAAWKSAPALACGNSMVFKPSPLTPVTAVLLAEIYAKAGAPEGLFNV
VQGGQETGTLLCHHPDVAKVSFTGSVPTGKKIMEMCSKGVKHVTLELGGKSPLLIFEDSD
LKNAVNGALMANFLSQGQVCSNGTRVFVQRQILPEFLKEVVRRTKAIEIGDPQLDSTRMG
ALISRPHLNRVLGFVEQARKEGAKVLCGGERFVPSDPKLSGGYYMTPCVLGDCSDEMTCV
KEEIFGPVMSVLSFETEEEAVRRANASALGLAAGVFTSDVKRAHRVVEQLKAGSCFVNNY
NITPVEVPFGGFKMSGIGRENGQVTIEHYTQMKTVFVEMGDVDSLF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttacaactacacaaagatgcttcaaaaacaacttgcagtcgtccgacggctg
cgatctgctgctctacttcctacgtgtatacgtagcatttcgtccgggaccatggacgtc
caattcccattgaacttctggagcggagaccgagtgaagattaaaaatgagtcaacctca
gagcctgtttacgaacctgcaactggtagggttctgtgtaacctggagtcgtgtggaact
gtggaggttgatcaggcagtgcaagccgcccagtcagcctaccagacctggaacaggatg
tcagggatggagagggcacgcatcatgattgaagcggcccgtattattgagaacaggaga
gaggacattgcagagatcgaggtggtgaacaatgggaagtcaatcacagaggcccggatg
gatgtggactctgccagactgtgtatagagtactactctgggctggccaacactctggca
ggacagcatgtccagctgacggggggatcttttgcctacacacgccgagagcctctaggg
gtctgtgtggggattggagcctggaactaccccttccaaatagctgcctggaagtctgcc
ccagccctggcctgtggcaactccatggtgttcaagccttctcccctcaccccagtgaca
gcggtgctgctggctgagatatatgccaaggccggagccccagagggactgttcaacgta
gtccagggtgggcaggagacgggcaccttgttgtgccaccaccctgacgtggctaaggtc
tccttcactggcagtgtgcccacaggcaagaagatcatggagatgtgctccaagggggtg
aagcatgttacactcgaactgggtgggaagtctcctctgctcatatttgaggacagtgac
ctgaaaaacgcagtgaacggggctctcatggctaacttcctttctcagggccaggtgtgc
agcaatggaactcgggtttttgttcagagacagatcctgcctgagttccttaaggaggtt
gtgaggagaaccaaggccatagagataggggacccacagttggacagcactcgtatggga
gcactgatcagccggccacatcttaacagagtcctaggctttgttgaacaggccaggaaa
gagggagccaaggtgttgtgtggaggggaacgatttgtcccttcagatcccaaactcagt
ggtggatactacatgacgccctgtgtgttgggtgactgctctgacgaaatgacgtgtgtg
aaagaggagatctttgggcctgtgatgtctgtgttgtcctttgaaacagaggaagaggct
gtgcggagggccaatgcctctgcccttggcctggctgctggggtcttcaccagtgatgtg
aagcgagcccaccgtgtagttgaacagctgaaggccggatcctgctttgttaataactat
aacatcactcctgtggaggtgccgtttggagggttcaaaatgtcaggcatagggagagag
aatggtcaggtgacaatagagcactacacacaaatgaagacagtgtttgtagagatgggg
gacgtagacagtctcttctaa

DBGET integrated database retrieval system