KEGG   Esox lucius (northern pike): 105022458
Entry
105022458         CDS       T04894                                 

Gene name
csrnp3
Definition
(RefSeq) cysteine/serine-rich nuclear protein 3 isoform X1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105022458 (csrnp3)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105022458 (csrnp3)
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105022458 (csrnp3)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105022458 (csrnp3)
SSDB
Motif
Pfam: CSRNP_N CDC45 PCM1_C Paf1 TFIIF_alpha
Other DBs
NCBI-GeneID: 105022458
NCBI-ProteinID: XP_010889197
UniProt: A0A3P9AGI4
AA seq 625 aa
MNGAAVETERRAMSGILKRKFDEVEASSSPCSSLRESDDEVSCSESGDSSDSVNPSASGP
FTPDSILKREKRVRTRRVHFENVTVYYFSRRQGFTSVPSQGGSTLGMSNRHSCVRQYSLG
EFSLEQERIHRDMLRDHLKEEKLNSIKLKLTKNGTVESEEANSLTAEDISDDDIDLDNTE
VDEYFFLQPLTTKKRRALLRTSGVKKIDVEEKHELRAIRVSREDCGCDCRVFCDPETCAC
SVAGIKCQVDRMSFPCGCTKEGCNNTAGRVEFNPIRVRTHFLHTIMKLELEKSREQQQAS
PANSYHGESNGHGNPLVQSQRSLEYSLSDPIVQQSAIMQLQSADDMDGPLDDEDEDEEDE
EENEEDEEDEEDSSSICSRLSDSSTQSLANSDSEEEEEEEDDEEEEDKVENFENGVAATP
VSHTEVVPLSSVLCYSDGTAPHHNHANGNSFLPSSPAEYYQLENPGAVASANGTTSQPSQ
TYREASSFPHSASTCNGSVVQASFNTTGPYTDSPHRDAEPYASQCFTLTNGTAAATTMGC
CSPDLDNNAVRSKGAFPEQAVGLSQFHNHLNNKSSLEGWGGNGKCFVAEQPKEVSIANGL
SDGPSLVESTMITPLAENLPQVTPV
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaatggtgcagcagtggagactgagaggagagcgatgagcggtatactgaaaaggaag
tttgatgaggtggaggcgtcctcctcgccctgttcctccttgcgggagtctgatgacgag
gtctcctgcagcgagagcggggacagcagtgacagtgtcaacccctcagcctcaggcccc
ttcaccccggattccatcctgaagagggaaaagcgtgtgaggacaagaagggtgcatttt
gagaatgtgacggtgtactacttcagccggcgccagggcttcaccagtgtgcccagtcag
gggggcagtactctgggcatgtccaatagacacagctgtgtcaggcagtactccctggga
gagttttccctggagcaggagaggatccatcgagacatgctccgagaccatctgaaggag
gagaaactcaactcaattaagctgaagctgaccaagaatggcacagtggagtctgaggag
gccaactcactcacggcggaggacatctctgacgacgacattgacctggacaacacagag
gtagacgagtacttcttcctgcagcccctgaccacaaagaagcggcgggctctgctgcgg
acctcgggggtgaagaagattgacgtggaggagaagcacgagctacgggccatccgggtg
tccagggaggactgtggctgtgactgccgagtgttctgtgaccctgagacctgtgcgtgc
agcgtagcaggaatcaagtgccaggtggaccgcatgtcttttccctgtggatgcaccaag
gagggctgtaacaacacggccggcagggtggagttcaaccccatacgtgtgcgcacccac
ttcctgcacaccatcatgaagttggagttggagaagagccgcgagcaacagcaggcctcc
cctgccaacagttaccatggtgaaagcaacggccacggcaacccgttggtccagagccag
cgcagtctagaatactctctctcagacccaatagtccaacagtctgccatcatgcaactc
cagtcagccgacgacatggacgggcctctggatgacgaagatgaggacgaggaggacgag
gaagagaatgaagaggacgaggaggatgaggaagacagtagcagtatatgcagcagactg
tctgactccagcacccagagcttggccaacagtgactctgaggaagaggaagaagaagag
gatgacgaagaggaggaggacaaagtagagaactttgagaatggagtggccgcaacgccc
gtctcccacacagaggtcgtccccctgtcctcagtgctgtgttactctgacggcacagcg
ccgcaccacaaccacgccaatgggaactcttttttacccagctccccggcagagtattac
cagctggagaaccctggtgcagttgcctcggccaacgggacgaccagccaacccagccaa
acctacagagaggcctcgtcgttcccgcactccgccagcacctgtaatgggtctgtggtg
caagcatcgttcaacacgacagggccgtacacagactctccccaccgggatgcggaaccg
tacgccagccaatgcttcaccctgaccaatggcacggcagccgctaccaccatgggctgc
tgctcacctgacctcgacaacaacgcggtccgatctaaaggagcgttccctgagcaggcc
gtgggcctcagccagttccacaaccacctgaacaacaagagctccctggaaggctggggt
ggtaatgggaagtgttttgttgcagagcagccaaaggaagtgtctattgctaatggtctg
tctgatgggccttctctagtagaaagtacaatgatcactccattagcagagaatctccca
caggttacgccagtttag

DBGET integrated database retrieval system