KEGG   Esox lucius (northern pike): 105022625Help
Entry
105022625         CDS       T04894                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105022625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105022625
G protein-coupled receptors [BR:els04030]
 Rhodopsin family
  Lipid
   Leukotriene
    105022625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 105022625
NCBI-ProteinID: XP_010889520
AA seq 368 aa AA seqDB search
MTQNHSINSPQSTRLEPAMDPDLEFSGGTAAASVILGLSFLVGAPGNLLVIWTILRHLKK
CSHTVVLILHLAVADLLVLITLPVWIYSLARSWVFGEAFCKATVYVVYSCMYGSVFLITL
MSVERVVAVRHPFASVKWRKKGSLNKVLLILWAMALLFSVPVIPTQVVLGDPGEEQCLYR
NYTSNVEEAGIVLLETMVGFVGPFFILVVSYSCLCSRIAQMNFKSKRKSTGLIASVVVVF
ALCWMPHHVGNMLSLIILAIQEYHHEAADRLESFKATMTFIAGALAFISSSVNPLLYVFA
ARSFRSSLRETGIQKLFRHISSTAPGEGTKELYFMTKKQSSSQMQSISSLCITEPKEQVD
VQCENCSS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaccattccatcaacagtccacagtctacacgtttagagccagccatggat
cctgatcttgagttttctggtgggacagcggcggccagtgtcatcttgggcctgtcattc
ctggtgggggcccctggaaacctactggtgatctggaccatccttaggcacctcaaaaag
tgctcccacactgtggtgctcattctccatctggctgtagcagacctgctggtgctcatt
accttacccgtgtggatttactccttggcccgatcctgggtcttcggggaggctttctgt
aaagccacagtgtatgtcgtctattcttgcatgtatggcagtgtcttcctcatcaccctc
atgagcgttgagcgtgtcgtcgccgtgcgacacccctttgcctcagtgaaatggaggaag
aagggatccctgaataaagttctactaatcctgtgggctatggccctccttttcagtgtt
ccagtcattccaactcaggtggtgctgggggaccctggagaggagcagtgtctctacaga
aactacacctcaaacgttgaagaggcagggattgttctgctggagaccatggtgggcttt
gtagggcccttttttatcctggtggtctcctacagctgtctctgtagccgcattgcacag
atgaacttcaagtccaagcgcaagtccacaggcttgattgccagtgtggtggtggtgttt
gccttatgctggatgccacaccacgtgggcaacatgctctccctgatcatcctcgccatc
caggagtaccaccatgaggctgcagatcgtctagagagtttcaaagccacaatgaccttt
attgccggggctctcgccttcatcagcagttcagtcaacccgttgctttatgtgtttgcg
gcacgttcgttccggagttccctgagggagacagggatccagaagttgttccgacacatc
tccagcacggccccaggagaggggactaaagaactgtactttatgaccaaaaaacagagc
agctctcagatgcagagcatcagctccctatgtatcacagaacccaaggagcaagtggat
gtacaatgtgaaaactgttcatcctga

DBGET integrated database retrieval system