KEGG   Esox lucius (northern pike): 105022964
Entry
105022964         CDS       T04894                                 

Definition
(RefSeq) cysteine/serine-rich nuclear protein 1-like isoform X1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105022964
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105022964
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105022964
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105022964
SSDB
Motif
Pfam: CSRNP_N
Other DBs
NCBI-GeneID: 105022964
NCBI-ProteinID: XP_010890071
UniProt: A0A3P8YJ59
AA seq 633 aa
MSEVLKRKFSEVEEEDPAYIHFSPSPPPPSSSSSSSLSSLATSEWESEGESSHSENNFSP
ASPSSQLPARSILKRPRLSQDNDRRANSVAFNQVTVFLFRRCQGFTSVPSRGGATLGMAR
QHSALRRYTLAEHAQERRRKLRKRLRNRVREERLEALRQRLMASGTMDQDGANRLTVDHV
SDDDIEAQLPEADPEEGEDGGDGGFLYPYASRQRQALLRAAGVRHIDREEKRELQALRRS
REDCGCDCRGFCEPETCACSLNGIKCQMDRSSFPCGCTKDSCGNTNGRVEFNSRRVQTHY
IHTVMRLELEQRLQDETLTKGRDLEENQEGLQPLQGQCQQDSVQEERCPFGFTLEEEGLP
LSVSTRPTFHFSPELCEVGENSCSSDMTDSSGYSAQSEDSDTGGSPQQHQPLLDVDEGGL
ARVLSFRDSDNDDCSMGSERDARPVRQPSPPLPRCLGSFETSYSLCEDTTGPSALSNTPS
SHTSNAYRHKDETRRHTDNSVSISSFMTDYLDENANQATALFADSPLQDYPNTPSPSIDY
SSCSYMDLSLSSNSDLELFDNFPTDYSSGPLHNSFKGHKHPDNFLHLQVLSSANVQQFNE
PAGTCLLESLMGLSETTDTPSFQDSQLLEQVIQ
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgagtgaggtcctgaagaggaaattttcagaggtggaggaggaggaccctgcctacatt
cacttctctccctctcctccgcccccctcctcctcctcctcctcctccctctcctcgctt
gccacctcggaatgggagtcggagggggagagctcccacagtgagaataacttctcccct
gcctcaccttcttcccaattacccgcccgctccatcctgaagaggcccagactttcccag
gacaacgaccgccgtgccaacagcgttgccttcaaccaggtgaccgtgttccttttccgg
cgttgccagggttttaccagcgttccgagccgtggcggcgccaccctgggcatggcaagg
caacacagcgccctccggaggtacacgctggcagagcacgcgcaggagagacgacggaaa
ctcaggaagaggcttcgaaacagagtgagggaggagaggctggaggcgctcaggcaaaga
ctcatggccagtggcaccatggaccaggacggggcgaatcgtctcaccgttgaccatgtg
tctgatgacgacattgaggcccagcttcctgaggctgacccggaggaaggagaggatggg
ggagacggtggctttctgtacccctacgcgtcccgccagaggcaggccctgctccgggcg
gctggggtgaggcacattgaccgtgaggagaagagggagctccaagctctgaggagatcc
agggaagactgcggctgtgactgccgaggcttctgtgaaccggagacctgtgcctgtagt
ctgaacggaatcaagtgccagatggaccgctccagcttcccctgcggctgtaccaaggac
agttgtggcaacaccaacgggcgcgttgagttcaactcccggcgtgtccagacgcactac
atccacaccgtcatgaggctggagttggagcagagactgcaggatgagacgctgaccaag
gggagggacctggaggagaaccaagagggactacagccgctccaggggcagtgtcagcag
gacagtgtccaggaggagagatgtccctttgggttcaccctggaagaagagggcctacct
ctctctgtctccacccgccctactttccacttcagccctgagctctgtgaggttggagag
aatagttgctccagcgacatgaccgactcgtccggctactctgcccagagcgaggactca
gacacgggtggaagccctcagcaacaccagcctctccttgacgtggatgaggggggcctg
gcgcgcgtcctcagcttccgggactctgacaacgatgactgctccatgggcagtgagagg
gacgctaggcctgtcagacaaccatcgccgccccttccccggtgtctcggcagctttgag
acgtcgtacagtctctgtgaagacaccacaggccccagcgccctgtccaacacacccagt
tcacacacaagcaacgcctacagacacaaagacgagacacgccgacacacagacaacagc
gtcagcatttcttccttcatgacagactatttagatgagaatgccaaccaagcgacggcc
ctgtttgcagacagtcctctccaggactaccccaacacaccctctccctccatagactac
tcatcctgcagctacatggacctcagcctctcctccaactcggacctggagctctttgac
aactttcccacagactacagttcaggccctctgcacaactcatttaaaggccacaagcac
ccagataactttctgcacctacaggtgttgagttcagcaaatgtccaacagttcaatgag
ccagctggtacttgtctcctggagtccctgatgggcttgtctgaaactacagacacacca
tcattccaagacagtcagctattagagcaggtgattcagtga

DBGET integrated database retrieval system