KEGG   Esox lucius (northern pike): 105023119
Entry
105023119         CDS       T04894                                 

Gene name
trhde
Definition
(RefSeq) thyrotropin-releasing hormone-degrading ectoenzyme isoform X2
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105023119 (trhde)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     105023119 (trhde)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105023119 (trhde)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N SprT-like
Other DBs
NCBI-GeneID: 105023119
NCBI-ProteinID: XP_012993943
UniProt: A0A3P9A0I6
AA seq 1006 aa
MPFENKRGNKGLSFTQMGIEDNNMRNGRGLSDQWADSVVVRPRTTERSITVHKRLVLGFA
ISILTLIIVTVIAVLLSIRFEECAGESSSRAGNGSNAKFNGSRDGNGNHKDEETQPWRHH
RLPASLRPRHYDLRLAVYMDNFTFSGEVNIEFECVYTTKFIVLHMDGLELEKVAVYSDNK
KPGVMRIHRQFHYPANQVYVIALHRELKPMRTYKVNITFEAQIENELLGFFRSSYMLHGE
RRYMAVTQFSPTHARKAFPCFDEPVYKATFRVILRHDASYLSLSNMPVEASISDDDGWVT
NHFARTPRMSTYYLAWAVCNFTYRETITDSGVVVRLYARPNAIQSGAGDYALHITKRLLQ
FYEDYFKVKYSLPKLDLLAVPKHPYAAMENWGLSVFVEQKILLDPEVSSFSYQMELTMVV
VHEICHQWFGDLVTPVWWEDVWLKEGFAHFFEYVGTDFLFPKWNMEKQRFLTDVLHEVML
LDGLASSHPISQEVYEAVDIDRVFDWIAYKKGAALIRMLANVMGEQVFQRGLNDYLMTHM
YSNAARDDLWNKLTEAMQNEGKDINIKEVMDHWTLQMGYPVVTISKNDSLDHSVTVTQEH
FIYDQDAKIRDPDLFNKSFQWQIPLTLATGNSTHRSPEAIIWLSNKTETHKVGRMDEDTW
LLGNINQTGYFRVNYDLHNWRLLIEQLMTNPEIISVGNRAGLIDDVFNLARAGYLPQNVP
LQIICYLPQEREFLPWHAASRSLYQLDKLLDRTEDYNLFSDFVLKQVASKYHKMGWPSAL
TDGSILQTSYQIEELQREVIMLACSFGNKQCHRQAVSLISDWISSNKNRIPPNVRDIVYC
TGVSLMDEDVWEFIWMKFHSSTAISEKKVLLEALTCSDNGFLLNRLLNLSLSSDLVPDQD
VIDVIIHVGRNPHGRQLAWRYFREKWDVLNSRYGEALFMNSKLISGVTEFLNTETELNEL
KEFIQISGGGAGPAFARAVEIVEANVRWHSLHERQFFQWLRKSPNG
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgccttttgagaataagcgtggcaataagggtttatcattcactcagatggggatagag
gataataacatgaggaacggccgaggcctgtcggatcaatgggccgatagcgtggtggtt
cggccacggaccacagagcggagcatcaccgtccacaaaagactggtcctggggttcgcc
atctctatactcactctcatcattgtcacggtaatcgcggttctcctcagcatccggttt
gaggagtgcgccggggagagtagctcacgagcgggcaacggctccaacgccaagtttaac
gggtcccgggatgggaatgggaaccacaaagacgaggaaacccaaccgtggcgacaccac
cggttacctgcatctctccggccccgccactacgacctccgactcgcagtgtacatggat
aactttactttctccggggaagtgaacattgaattcgagtgtgtatacaccaccaagttc
atagtgctgcacatggacggtctcgagctggagaaagtggcagtgtattcggataacaaa
aaacccggagtcatgagaatccaccgccagttccactacccagccaaccaggtttatgtg
atcgcgttgcacagggaactgaagcccatgaggacttacaaagtaaacattacttttgaa
gctcaaatagaaaatgaactcttgggatttttccgcagctcgtatatgctacacggcgag
agaaggtacatggcggtgacacagttctcccccacccacgccagaaaggccttcccgtgt
ttcgacgagcccgtctacaaggccacgttccgggtgatcctgaggcacgacgcatcctac
ctctccctgtccaacatgcccgtggaggcctccatctcggacgacgacggctgggtgacc
aaccacttcgcccggactcctcgcatgtccacctattacctggcctgggctgtctgcaac
ttcacctaccgggagaccatcaccgacagcggagtggtggttcgtctgtacgccaggccc
aacgccatccagagcggagcgggcgactacgccctccacatcacaaagagacttctccag
ttctacgaggattacttcaaagtcaaatactcactgcccaaattagacctcctggccgtt
cccaagcacccctacgccgccatggagaactggggcctgagtgttttcgtggagcagaag
atccttctggacccagaggtttcctccttctcatatcagatggagctgaccatggtggtg
gtgcatgagatctgccatcagtggtttggcgacctggtgactccggtatggtgggaggac
gtctggctgaaggaaggcttcgctcacttctttgagtacgttggaacggactttctcttt
cccaaatggaacatggagaagcagcggttcctgactgacgttctccacgaggtgatgctg
ctggatggtttggccagctcccaccccatttcccaggaggtctacgaggctgtggacata
gacagagttttcgactggatcgcgtacaagaagggagctgctctcattcggatgctggca
aacgtcatgggagagcaggtgtttcagaggggactcaatgattacctgatgacacacatg
tacagcaacgcagcccgggatgacttgtggaacaagctcactgaggccatgcagaacgag
ggcaaagacatcaacattaaggaggtcatggaccactggaccctccagatgggctaccca
gtagtgaccatcagtaagaacgacagcctggatcacagtgtcaccgtcacacaggaacac
ttcatctacgaccaggatgccaagatcagagacccagacctcttcaacaaaagttttcag
tggcagattcctctgacattagccacggggaattcaactcacagatccccagaagccatc
atctggctctccaacaaaacagagacgcacaaagtaggccggatggatgaggacacatgg
ttgctaggcaacatcaaccagacggggtacttccgggtgaactacgacctccataactgg
aggctcctcattgaacagctgatgaccaatcctgagataatctctgtcggcaacagggcg
ggtctcatcgatgatgtcttcaatctggcgagggccggttatctgcctcagaatgtgccc
ctccagatcatctgctacctcccgcaggagagagagttcctcccctggcacgccgccagt
cgatccctgtaccagctggacaagctgctggaccggacagaagactacaacctctttagt
gactttgtgctgaaacaagtggcctctaagtaccataagatgggctggccctccgctctc
accgacgggtccatcctgcagacatcttatcagattgaagagctgcagagggaggtgatc
atgctggcctgcagttttgggaacaagcagtgtcaccggcaggccgtgtcactcatctct
gattggatctcaagcaacaagaacagaataccgcctaatgtgcgagacatcgtgtactgt
acaggcgtgtccctgatggacgaggacgtatgggagttcatctggatgaagttccactca
tccacagccatctcagagaagaaggtcctcctggaggcactcacctgcagcgacaacggc
ttcctgctcaaccggctgctcaatctgtctctgagttcggatctggtgccggatcaagac
gtcattgatgtcatcatccacgtgggacggaacccccacggcagacagctggcctggagg
tacttcagagagaagtgggacgtcctgaattcgcggtatggagaggctttattcatgaat
tcgaagctaatcagcggggtgactgaattcctaaacacagagacggaactgaacgagctg
aaagaattcatccagatcagtggaggaggggcgggtccagctttcgcccgggccgtggag
atcgtagaggccaacgtgagatggcacagtctccatgaacgccagttcttccagtggcta
aggaagtcacccaacggttaa

DBGET integrated database retrieval system