KEGG   Esox lucius (northern pike): 105023469
Entry
105023469         CDS       T04894                                 

Definition
(RefSeq) aminopeptidase N
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00480  Glutathione metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105023469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105023469
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105023469
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105023469
   04090 CD molecules [BR:els04090]
    105023469
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     105023469
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105023469
Membrane trafficking [BR:els04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    105023469
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   105023469
CD molecules [BR:els04090]
 Proteins
  105023469
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 105023469
NCBI-ProteinID: XP_010890993
UniProt: A0A3P8YMG7
AA seq 971 aa
MAKGLYISKVLAIATVVLTVSSIGGIIAMMIAYETMRIEVMPTPPPTPIITTPYPTGPPP
NMRLPGNLIPKSYDILLQPHLYTVMTNATNQSLIFTGNSTVCFKCLKNTTTIILHSKEQN
VNAVRVTDVDNIKSIKITETLLYGNESNFLEIRLDGLLVEGGNYCLVTEFQGELLDDLAG
FYLSSYKKGPGKEDDTERMFGNETIVVELDERYIAASQMQPTDARKVFPCFDEPAMKATF
KVTIIHRRGTTALANGKETERKYVDIDGETWQVTFFQETKIMSTYLLAIAVSDFDFIESE
YKRVTIKTYARPEAIKAGHANFAASITGKILDFYESPKCFDMSFPLSKLDQIALPDFSAG
AMENWGLVTYRETALLYEDGVSSTANKEWIATVIAHELAHQWFGNMVTMKWWNDLWLNEG
FATYISYMGVDNIKPEWHMKDLIVLNDIQPAFQVDSLASSHPLSSKEDDIQTSNDITELF
DVITYSKGAAVLRMLEDLLSERLFLTGLRNYLQAFMYNNTVQNDLWDYLQKAVDANGDEY
IIAELMDTWTNQMGYPVITINTTTGAVFQRHFLLNQTSDYNFEWHVPIRVMKEGKRLDLD
MLKPKETDPHPKLQSENDKWVLANVDCKGYFRVNYDPANWDRLLSQLERNIHKIPIINRG
QLIDDAFNLARAKQINVTLALRTTKYLRNDTEYIPWESALRNLDYFILMFDRSEVYGPIQ
AYLRKQVRGLYQHFENVTMNSTAIDQLSHSEQYNHINSILVACSNEIQDCQKMVTTFFDD
WMTNKTGNNIHPNLKAIIYCQAIAAGGEKEWEFAWGQFQNATTATEKDKLRYALSCTKKI
WLLNRYLEYTLDPDKIRKMDAVSTINYIARNVAGQAIAWNFVRANWKSISLDYGGGIMSL
GGLIEGVTQRFSTDFELHELRQFQSNYNEELGSASRALEQAIERTQANIKWVKENKQTVL
EWFRRETSESS
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggccaaaggactgtatatctccaaggttttggccatagccacagtggtgttgaccgtc
tcatccatagggggaataattgcaatgatgattgcgtatgagaccatgagaatcgaggta
atgcctacaccaccaccaacgcctattatcacgactccgtatccaaccggacccccaccc
aacatgagactccctggaaacctgattcccaaaagctatgacatcctcctacagcctcac
ctgtacaccgtgatgaccaacgctaccaaccaatctctcatcttcactggaaactccaca
gtctgtttcaaatgtttgaaaaacaccacaactataattcttcacagtaaagaacagaat
gtgaatgctgtacgggtgaccgatgtagacaacataaagagcatcaaaattacggaaact
ttattgtatggtaacgagagcaacttcttagagatccgactggatggtttgttagtggaa
ggtggaaattactgtctcgttacagaatttcagggagagctccttgatgatctagctggt
ttttacctaagttcatataaaaaagggccaggcaaagaagatgacactgaaaggatgttt
gggaatgaaaccatcgtcgtcgagcttgatgaaagatacattgcagctagccaaatgcag
ccaaccgatgctcggaaggtgtttccttgttttgatgagccagccatgaaggctacattt
aaagtcactatcatccataggcgtggcacgacagcactagcaaatggcaaagagacagaa
agaaaatatgtggatattgatggagagacctggcaagtcacattctttcaagagaccaag
attatgtcaacttacctcttagctattgcagtgtctgattttgatttcattgaatctgaa
tataaaagagttacaattaagacctatgctagaccggaggccatcaaagctggacatgca
aattttgcagcaagtatcactggaaaaatactggacttctatgagagtcctaaatgtttt
gacatgagttttccattgagtaaactagatcagattgctctaccagacttcagtgcaggt
gccatggagaattggggtttggtaacataccgggagacagctctgctatatgaagatggg
gtgtcttccacagctaacaaagagtggattgccacagttattgcacatgagcttgcccat
cagtggtttggaaacatggtgacaatgaaatggtggaatgacctgtggctgaatgaagga
tttgcaacatatatctcctatatgggagtggataacataaagccagagtggcacatgaaa
gatctgattgttttaaatgacatccagccagcattccaagtggattcgttggcttcatca
catcctctgagctctaaagaggacgatattcaaacttctaatgacatcactgaacttttc
gatgtcattacctacagcaagggggcagctgtcctgagaatgctggaagatctactgagt
gaaaggttgtttctgactggtctgagaaactatcttcaggctttcatgtacaataatact
gtacagaatgacttgtgggattatttacaaaaggcagtggatgctaacggtgacgaatac
atcattgctgaacttatggacacttggacaaatcaaatgggctacccagtcattactatc
aacacaaccactggggcagttttccaaagacatttcctcctaaatcaaacatctgactac
aattttgaatggcatgtaccaatcagagtgatgaaggaaggaaaacgcttagatttagat
atgctgaaaccaaaagaaacagacccacatccaaagctccagtctgaaaatgacaagtgg
gtgcttgctaatgtagactgcaaaggatatttcagagtcaactatgatccagcgaattgg
gatagattgctctctcagctggaaagaaatattcataaaatcccaatcatcaaccgtgga
cagttaattgatgacgcattcaacttggcaagggccaaacaaatcaatgtgacactggct
ttgagaactactaagtacctccggaatgacaccgagtacataccatgggaatctgcgctg
agaaacctggactatttcattcttatgtttgatcgctccgaggtctatggcccaatccag
gcatacttgcgaaagcaagttcgtggcctttatcaacattttgaaaatgtcactatgaat
tcgacagccatagaccaactgagccattctgaacagtacaatcatattaactccatctta
gtcgcatgcagcaatgaaattcaagactgccaaaaaatggtaacaacattctttgatgac
tggatgacaaacaaaaccggcaataatatacaccctaacctgaaggccatcatctactgt
caagctatagcagctgggggagagaaggagtgggaattcgcttggggtcaatttcagaat
gccaccacggccacagagaaagacaaattaagatatgccctctcatgcaccaagaagatc
tggctcctgaacagatacctggagtacactttggaccctgacaagatcagaaaaatggat
gctgtttccaccatcaactacattgctagaaatgtggcagggcaagcaatagcctggaat
tttgtacgtgcaaactggaagagcatcagcttggactatggcggagggatcatgtcattg
ggcggactgatcgagggagtgacgcagagattttccacagactttgagctccatgagctg
aggcagttccagagcaactataatgaagaactgggttctgcaagcagggccctagagcaa
gccatagagagaacccaggccaacattaaatgggtgaaagaaaacaagcagactgttctg
gagtggttcagaagagaaacaagcgaaagcagctga

DBGET integrated database retrieval system