KEGG   Esox lucius (northern pike): 105023938Help
Entry
105023938         CDS       T04894                                 

Definition
(RefSeq) autophagy protein 16
Organism
els  Esox lucius (northern pike)
Pathway
els04136  Autophagy - other
els04140  Autophagy - animal
els04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105023938
   04136 Autophagy - other
    105023938
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105023938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 Fez1 Spc7 DIT1_PvcA DUF4407 DUF745
Motif
Other DBs
NCBI-GeneID: 105023938
NCBI-ProteinID: XP_010891793
AA seq 230 aa AA seqDB search
MESWKSHVRAELFQRDCTQKDPFSGVFGTLSKLAEQFNLRETFWDEVQRPSFKGDGGLTV
DHKELQLQLRESEHITEKLSQTVSDLTTVLYLKDAELQYCHSQVSRYRKEAVTQARGANV
LQVSLLNCESELERISKELTALQLEQQELREELAAASREKEELLERWMEEKKDEAERVNR
HNDTQERWHRFTRRLNKHLRREMMQPEQTSGHAGHVLQGLIPPGGPSTPK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttggaaaagtcacgtccgcgctgaacttttccagcgagattgtacgcaaaag
gaccccttcagtggtgtctttggcactttgtccaaacttgcagagcagtttaatttacgg
gagacattttgggatgaggtgcagagacccagttttaaaggagatggtggactgacagtt
gaccacaaagagctacaacttcagctcagagagagtgaacatataacagaaaagctctcc
caaacagtctctgacttgactactgtcctttacctgaaagatgcagagcttcaatactgc
cactcacaagtgtctcgctatcgtaaggaagctgttactcaagccaggggggccaacgtt
ctgcaggtcagtctattaaattgtgagtctgaattggagagaatttcaaaggagttgaca
gccctgcaactggagcagcaagaactgagggaggagcttgcagcagctagtagagagaaa
gaggagcttttggagcgatggatggaggagaagaaggacgaggctgagcgagtgaacagg
cacaatgatacacaggaaagatggcatcgttttacccggcgactcaataagcatctccgg
agagagatgatgcaaccagaacaaaccagtggtcatgctgggcatgtgctgcagggcctc
atacctccagggggcccctcaaccccaaaataa

DBGET integrated database retrieval system