KEGG   Esox lucius (northern pike): 105023982
Entry
105023982         CDS       T04894                                 

Gene name
rpap2
Definition
(RefSeq) putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
  KO
K20827  RNA polymerase II-associated protein 2 [EC:3.1.3.16]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105023982 (rpap2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105023982 (rpap2)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105023982 (rpap2)
Protein phosphatases and associated proteins [BR:els01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   105023982 (rpap2)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105023982 (rpap2)
SSDB
Motif
Pfam: RPAP2_Rtr1 ComC
Other DBs
NCBI-GeneID: 105023982
NCBI-ProteinID: XP_010891878
AA seq 615 aa
MESRKRVARSSKASKKDGKSVKAQTAAELARRTEATRVTFRERVQLEKRAVQVVERLLDN
NVNEDLLVECARLITPTHYKDVVEERSIVKLCGYPICSNRLGKVPTQQFKISTKTNKVYD
ITERKCFCSNYCYKASKSFELQIPKSPLWLREHDSIPEIKLMKHGDGGSSGEALTLAERR
LREEDVENPLPLGPVASEDPSGARPSPIATRSDDSETEQDFVSSMVSQRQRPRVHWGDID
KVDAGEPGEGEEMERRPARRGTTEEDREGDDTAETQTEGSDHVREKGSPEGQSVEEVVEL
LNHVTVQDRDSAAAQSGVPDHGPTPSPQGDSGPPAQPGLSITQVGMSRRGARGLRGLLTG
LEAPRKPVSVRLKRLEDLRRTFKEWRTDETLEFLYGPDHFSKVPMETRNKMEEHVELDED
DLEDIVAGGDTFPGCPGRPSATAPDYETLCRETEELGLRVREFYKGTFILPEEAQQLEEK
QARDLEDQDVKVPSFPLIDSRAQRLIQKRIAVEKISRSLRDVLGPLRLTMADIFSDLNNL
VRTLRLTNTNIIHKAPEWTLITVVLLHVLSELSPVVRQALESPASVEYLSALMQELQLQD
LDFQSLVRLFKTPDH
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagtcacgaaaaagagttgctcgttcttcaaaagcaagcaaaaaggatgggaaaagt
gtcaaagcacagaccgctgcagagttagcaagaaggaccgaggccacaagggtgaccttc
cgggagagggtgcaactggagaagagggcggtacaggtggtggaacgtctcctggacaac
aatgtaaatgaggacctgctggttgaatgtgcaaggttgatcactcctacgcactataaa
gacgtagttgaggagaggtctatcgtgaagctctgtggttatcctatctgttcaaataga
ctgggcaaggtgcccactcaacagtttaaaatatccaccaaaaccaataaagtctatgac
ataacagaacgcaagtgcttctgcagtaactactgctacaaagcctccaagtcgtttgag
ctccagataccaaagagccctctatggttgagagagcacgacagcatcccagaaataaaa
ttaatgaaacatggcgatggcggtagcagtggagaggcgttgacgcttgctgagaggcgt
cttcgagaagaggatgtggagaaccccctcccccttggtcctgtagcctccgaggacccg
tcgggggccaggccctcccctattgccacacggagtgacgacagtgaaacggaacaggac
tttgtctccagcatggtctcccagcgacagagacccagggtgcactggggcgacatcgac
aaggtggacgcgggagaacccggtgagggggaggagatggagaggcgtcccgcacggagg
ggcacaacggaggaggacagggagggcgacgatacagcggaaacccagacggaggggagc
gatcacgtgagagagaaaggttcgccagagggccagtctgtggaggaggtcgtggagctg
ctgaaccatgtcacagtacaggatagagactcagccgccgcacaaagcggtgtaccagac
catggtcccacccccagcccgcagggggactctggaccgcccgcccagcctggcctcagc
atcacccaggtgggcatgagcaggagaggagcccggggcctccgggggcttctcacgggc
ctggaggcaccacggaagcctgtctctgtccggttgaaacgtctggaagatctaaggagg
acttttaaggaatggcgtactgacgaaactttggagttcctatatggcccggaccacttt
agtaaagtgcctatggaaacaaggaacaagatggaggagcatgtggagctagatgaagat
gacctggaagacattgtagcaggtggagacacgttcccagggtgtcctgggaggccctcc
gctacggcccctgactatgaaaccctatgcagggagaccgaggagctgggcctaagagtc
agggagttctacaaagggacttttattctacctgaagaagcccagcagctggaagagaaa
caggcccgagacttggaggaccaggacgtaaaggtgccttcattcccgctcattgactcc
cgtgcccagcggctcatccagaaacgcattgcagtggagaagatcagtagaagcctgaga
gatgttctgggccctctgcgtctgaccatggctgatatcttcagcgacctcaacaacctg
gtcaggaccttgaggctcacaaacaccaacatcatccacaaagccccagagtggaccctg
atcactgtggtgctcctccatgtgttatcagagttgtccccggtggtgaggcaagccctg
gagagcccggcttcagtggagtacctctcggctcttatgcaggagctccagctgcaggac
ctggacttccaaagcctagtgcggctattcaaaaccccagaccactga

DBGET integrated database retrieval system