KEGG   Esox lucius (northern pike): 105024028
Entry
105024028         CDS       T04894                                 

Gene name
mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105024028 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105024028 (mecom)
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    105024028 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_8 zf-BED zf-C2H2_11
Other DBs
NCBI-GeneID: 105024028
NCBI-ProteinID: XP_010891949
UniProt: A0A3P8Z541
AA seq 1291 aa
MRSKGRARKLATSDSDDFALYTSNMLDSVCLLDGDPTVPPSAPQEDPPSPGFSCEDNTSP
LEPSHFHSSLYMPQDELSVPPDFQLRQSGVPSVGDGLGIWARRTVDVGERFGPYVGEQQM
CLRDPTQDWEILNGSGHAKFCVAASKPDIGSWLKHIQFAPTAHQHNVTRCQIDDQIFYRV
TREIQPGQELLLFMKAEEYSCDIMAPDMHEERQYHCEDCDQQFESRSELLDHQKVPCGTP
PSAFLGNPGGDSSDLEGPEGLEPHELHPSDFHLSHSLSDHNQDGPRECRECDQVFPDAQS
MEAHSLSHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCTKQVFTDPSNLQR
HIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFICKSLRPFICEVCHKSYTQF
SNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAHAQGMSLP
GAPGAMDKASLGGMGHSSASLADYFGNRHHSGLTFPAAPGFPFSFPGLFSSGLYHRPPLI
PATSPVRRPPGPGTEHNKSPLLSPSPGAQEARDLLKNLRKEVSPDSETPQGVEQRPAQGP
SSKQRHGGGKMSDQSESSDLDDVSTPSGSDLETTSGSELESDMESEGQRERAPRENGKGP
KRKAGGGPNCPTPLNSNHTKEFPVGSALYPPSLDEHTAVSGAVNDSIKAIASIAERYFGS
TGLAGLQDKKVGALPYPSMFPLPFFPAFSPPVYPFQERELRPPGLKGEPPSQPDEPTKKG
QSRTSESPFDLTTKRKQEDKIPAPFTSNSKPEASSHSTNQDQPLDLSMGGTRNRSSSRAP
RGEESKSNHMFGEDKAGVELPKADTSLQHARPTPFFMDPIYSRVEKRKMNDPFEALKDKY
MRPAPGFLFHPQFRMPDQRTWMSAIENMAEKLETFGSLKPESGDLMRSVPSMFDFRAPPT
ALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
IRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPRSELDSSSAILDDK
EDSYFNEIRNFIGNTGQTQPSPDHSEEGLNSGPFEEEKPLMVSHTSHDLDEEEGEELGGE
EDEGEHSDSAAGKPGDEALPDNLDDEIIHNDIDFDGPSDLELNCKTSPRRYEEEDQSSYS
ALDHIRHFSDMRKMEDSEFSDGDSTSFRSPSLSDAVKQPLYRKSKSQAYAMMLSLADKDA
LHQANHTPATMWHSLARAAAESSAIQSLSHV
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgatagtgacgactttgccctc
tacacatctaatatgctggacagtgtgtgcctgttggatggagaccccacagtgccaccc
tcggccccccaagaggaccctccctcccctggcttctcctgtgaggacaacacctctccc
ctggagccatcccacttccattcctccctctacatgccccaggatgaactgtcagttccc
ccagacttccagctgcgccagtctggtgtaccaagtgttggtgacgggctgggtatctgg
gcacggaggacggtggacgtgggtgagcgtttcggaccgtatgtgggcgagcagcagatg
tgcctgagagaccccactcaagactgggagatcttgaacgggtcgggccatgctaagttc
tgcgtggctgccagtaagcctgatatcgggagctggctaaagcacatccagtttgccccc
acggcccaccagcacaacgtgacgcggtgccagatagatgatcagatcttctacagagtg
acccgagagatccaaccaggacaggagctgcttctgttcatgaaggcagaggagtattca
tgtgacatcatggctcctgatatgcatgaggagagacagtatcactgtgaagactgcgac
cagcaatttgagtctcgttccgagctgctggaccaccagaaggttccctgcgggacaccg
ccctctgccttcttggggaaccctggcggggacagcagcgacctggagggtcccgagggc
ctagagccccacgagctgcaccccagtgacttccacctgtcgcacagcctcagcgaccac
aaccaggacggcccccgggagtgtagagaatgtgaccaggtgttccctgacgcccagagt
atggaagctcactctctgtctcactcggaggagagagaatacaagtgtgaccagtgcccc
aaggccttcaactggaaatccaaccttatccgtcatcagatgtcgcatgacagtggcaag
cactacgaatgtgaaaactgcaccaagcaggtgttcacagaccccagtaacctgcagagg
cacatccgctcgcagcacgtcggggcgcgggctcacgcctgtcccgactgtgggaaaacc
tttgccacgtcctcgggcctcaagcagcacaagcacatccacagcagtgtcaagcccttc
atatgtaagtcactcagacccttcatatgcgaggtgtgccacaagtcctacacacagttc
tccaacctgtgccgtcacaagcgcatgcacgccgactgccgcacccagattaagtgtaaa
gactgcggccagatgttcagcaccacctcatccctgaacaagcaccgccgcttctgtgag
ggcaagaaccatttcacagccggcgggttgtttgcgcacgcccagggcatgtccctcccc
ggtgcccccggggccatggacaaggccagtctgggcgggatgggccacagcagtgccagc
ctggcagactactttgggaaccgtcaccacagcggcctgacgttccccgccgcccctggc
ttcccctttagcttcccaggcctgttctcctccggactgtaccaccgaccgcccctcatc
ccggccacctccccagtcagacgaccccctggtccaggtacggagcacaacaagagccct
ctcctgtcacccagccctggagcccaggaggccagagacttgctcaagaacctccgcaag
gaggtgtcacccgacagtgagacaccacagggggtggagcagcgaccggcccagggccct
tcttccaagcagaggcatggcggtggcaagatgagcgaccagtctgagagcagtgacctg
gacgacgtgagcacgcccagcgggagtgacttggagactacgtcaggatcggagctggag
agcgacatggagagcgagggccaacgggagagggccccccgggagaatgggaaggggccc
aagaggaaggcgggcggaggccccaactgccccaccccgctgaacagtaaccacaccaag
gagttccccgtcggctctgccctgtaccccccctcgctggacgagcacacggctgtctct
ggagcagtgaacgactccatcaaggccattgcctcgatcgctgagaggtactttggctcc
acggggctggcgggcctgcaggacaagaaggtgggggcactgccctatccctccatgttc
cctctgcccttcttcccagctttctccccgcctgtctaccccttccaagagagggagcta
agacctccaggcctcaagggggagcccccatcccaacctgatgaacccaccaagaaaggc
cagagcaggacctctgagtcaccctttgacctcaccaccaagcgcaagcaagaagataag
atcccagcccccttcacctcaaactccaaaccagaggcttcctcgcattctaccaatcag
gaccagccactggatctgagcatgggcggcaccaggaaccgcagcagtagccgtgccccc
agaggggaggagtctaagagtaatcatatgtttggagaagacaaggcaggggtggagctt
cctaaagctgatacctctctgcagcatgcccggcccacccctttcttcatggaccctatt
tacagcagggttgagaagaggaagatgaacgatccgtttgaggctctgaaagacaagtac
atgcggccagccccaggcttcctgttccatccacagtttcgtatgccagatcagagaacc
tggatgtcggccattgagaacatggctgagaagctagagacatttggttcgctcaaacct
gagtcaggtgacctgatgcggtctgtcccctccatgtttgactttcgagccccgcccact
gctctccctgagacattactgcgcaagggcaaggagcgctacacctgcaggtactgcggt
aaaatattcccacggtctgccaacttgacccgccacttaaggacacatacaggagagcaa
ccatacaggtgtaagtactgtgaccgctcgttcagcatctcatccaatctgcagcgtcac
atccgcaacatccacaacaaggagaagccctttaagtgtcacctgtgtgaccgctgcttc
ggccagcagaccaacctggaccgccacctcaagaagcacgagaacggaaacctctcaggc
acggcggcttcttccccgaggtcagagttggacagcagcagtgccatcctggacgacaaa
gaagactcctacttcaatgaaatacgaaacttcatcggcaacacaggccagacgcagccg
tcccctgaccattctgaggaagggttaaacagtggtcccttcgaggaggagaagcccctg
atggtcagtcacacgtcacatgacctggatgaggaggaaggggaggagcttggcggcgag
gaggatgaaggggagcacagcgactctgcggctgggaaacctggagacgaggctctccca
gacaacctagacgatgaaatcatacacaatgatatagactttgacggaccaagtgatttg
gaactcaactgtaagacctccccaaggaggtacgaggaagaggatcagagtagctactct
gcgctggatcacatccgtcacttctctgacatgcggaagatggaggacagtgagttcagt
gacggggacagcacctcctttcgctcccccagcctgtctgacgctgtcaaacagcccctg
tacagaaaatccaagtcccaggcatatgccatgatgctttctctggctgacaaggacgca
ctccaccaagccaatcacacgccagccaccatgtggcacagcctggcccgggccgctgcc
gagtccagcgccatccaatccctcagtcacgtatga

DBGET integrated database retrieval system