KEGG   Esox lucius (northern pike): 105024076Help
Entry
105024076         CDS       T04894                                 

Gene name
gucy1a2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els01100  Metabolic pathways
els04270  Vascular smooth muscle contraction
els04540  Gap junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105024076 (gucy1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105024076 (gucy1a2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105024076 (gucy1a2)
Enzymes [BR:els01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105024076 (gucy1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB DUF4761
Motif
Other DBs
NCBI-GeneID: 105024076
NCBI-ProteinID: XP_010892042
UniProt: A0A3P8Y555
AA seq 770 aa AA seqDB search
MSSRKISSESFSSMGSECLESPGDDGDSCPFSRIWNGKSPVEKLACPFEDASAPKRATRR
KRVNLDSLGESLRRLTSPTTQMVQQSLQRTLEFYRQKEIRCREDGKQEKKSVSMEKCPLV
DDSGSGEEADVSGMLQYMATLQGVRFCELRERFGEEFFGLCFEENERVLRAVGGNLQDFF
NGFDAILEHIRTSTGRRASSESPSFQCKDPHEEERGRGGGSERVGGKLLLLHCFNPAPVV
GLAMPGLIRAVARRIFHSHVVVKEAPPLAPSLPNEDPELSGRDSTHSPTPSPSSSPSAPS
PSAPVCLSFLIRESSPSPPSIPPSIPPSSGLPSEPSKRSLPPLSLSPSDLRIGPATFCRA
FPFHLVLGPSMELLQLGEGLRRQARIELHRTLSFRDCFEIISPRIQPTFQAILLRLASPF
TIRTRPDYSQSGTKEKVMEVKGQMIHVPESSTLMFLGSPRVDKLEELMGRGLYLSDIPIH
DATRDVILVGQQAKAQDGLKIRMDKLKATLEKTHQALEEEKRRTVDLLYSIFPGDVAQKL
WQGESVPARKFDDVTMLFSDIVGFTAVCAHCTPMQVISMLNELYTRFDYQCGILDVYKIE
TIGDAYCVAGGLHRKIDSHAKPIALMALKMMELSEEVLTPDGKPIKLRIGIHTGSVLAGV
VGVRMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLKDDCAFSFIPRSRLELPDNF
PKEIPGTCYFLEGGTSHSHASLTSSRSAPPAPLRKVSYSIGTMFLRETSL
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgcgcaagatctcgtcggagtcgttcagctcgatgggttcggaatgcctggag
agccccggagatgatggagactcctgtcccttttcacgcatctggaacggcaagagtcca
gtagagaagctcgcgtgcccgttcgaggacgcttcggcaccgaaacgggcaaccagacga
aagcgcgttaacctggactcgcttggggagagcttgaggaggttaacgtcacccacgaca
cagatggttcagcagtctctacagagaaccttagagttctacagacagaaggagatcagg
tgcagagaggatgggaaacaagaaaagaaaagtgttagtatggagaagtgcccgttggtg
gatgattctggctcgggagaagaggcagacgtctcaggaatgctacagtacatggctaca
ctgcagggtgtacggttctgtgagttgcgggagcgtttcggcgaagagttttttggtctt
tgtttcgaggagaatgagcgggttctaagagcagtgggagggaacctgcaggactttttc
aacggtttcgatgcaatcttagaacacatcagaacctccactggacgccgcgcctcctct
gaaagcccatcctttcaatgcaaagaccctcacgaggaagagagagggagaggaggagga
agtgagagggtgggaggaaagcttctcctccttcactgttttaaccccgcccctgttgtg
ggattggctatgcctggcctgatccgtgctgtcgcacgcagaatcttccactcccacgtt
gtggtgaaggaagcccctcctctagcaccttcgttgcccaatgaggaccccgaactctca
ggcagagactccacccattctcctactccctccccttcctcgtccccctcagccccctcc
ccctctgccccagtctgcctctccttcctcattagggaatcatccccctcccctccctcc
attcctccctctattcctccctcctccggccttccttcagagccctccaagcggagcctc
cctcccctctccttgtccccatcagacctgcggatcggtccggctacattctgcagggcc
ttccccttccacctggtactgggccccagcatggagctactgcagctaggggagggttta
agaaggcaggcacggatcgagctccaccggaccctctctttcagggactgctttgagatc
atctctcccaggatccagcccaccttccaggccatactactgcgcttggcctctcccttc
accatccgcacccggccagactactctcagtcaggaaccaaagagaaggtgatggaggtg
aaaggtcagatgatccacgtcccagaatcctctactctgatgttccttggttccccccgg
gtggacaagctggaggagcttatgggcaggggcctctacctgtcagacatccccatccac
gatgccacccgtgatgtcatcctggtgggacagcaggccaaggcccaggacggcctcaag
atcaggatggataaactaaaggccacgctagaaaagacacaccaagctctcgaagaggag
aagaggaggaccgtggaccttctctactccatctttcccggggacgtggcccagaagctg
tggcagggcgagtcggttcccgccaggaagtttgacgacgtcaccatgctcttttcagac
atcgtgggcttcacggccgtgtgcgcccactgtacccccatgcaagtcatcagcatgctc
aacgagctgtacacgcgtttcgactaccagtgtggaatcctggacgtctataagattgag
acaataggtgatgcctactgcgtggcgggtggcctccatcggaagattgacagccacgcc
aagccaattgcactcatggctctgaagatgatggagctgtcagaggaggtcttaacgcca
gacggcaaacccatcaagcttcgtataggaatccatacaggctcagtcttggcgggggtg
gtcggagtgaggatgcctaggtattgtctgtttggcaacaacgtcacactggccagcaag
tttgagtctggaagccaccctcggtgcatcaacgtcagcccaaccacataccagctgctg
aaagatgattgcgccttctctttcatccctcgatcccgcttggagcttcctgataatttt
ccaaaagagatcccaggaacttgctacttcctggagggagggacttcccatagccacgcc
tcactgaccagctctcgctccgccccccctgctcccctgaggaaagtgtcctacagcatc
ggtaccatgttcctgagagaaacaagtttatag

DBGET integrated database retrieval system