KEGG   Esox lucius (northern pike): 105024247
Entry
105024247         CDS       T04894                                 

Definition
(RefSeq) uncharacterized protein LOC105024247
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105024247
Transcription factors [BR:els03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    105024247
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 105024247
NCBI-ProteinID: XP_012986784
AA seq 659 aa
MMIPPGECLYAGRKRRKPIQKHKQTASSQKTNPSKRHRDRLNTELDRLASLLPFTTEIIS
KLDKLSVLRLSVSYLRCKSFFQAIQEEPCGKHIAELAGNHQDTKTESVPNGTPRTGGNVV
ESDLLLESLTGFALVVSTDGLIFYASSSIVDYLGFHQTDVMHQNVFDYIHVEDRQDFRRQ
LHWAMNPRTQGASLDQTAATEAGDDIVVSSLFNGQEPDVVPLELSSFLTRCFTARVRCLL
DSASGFLSMQFQGSLKFLPGQKKKTECGALLPPQLALFCVAMPLMMPTFTELKMKSVAVK
SKNKGSILNTLDKTSDKRVRTSRDSCDSSGFLLQNLSTTTTRDSCHYTPWTSLFKDGIRN
KEDGYYTQVEPLNFCLSSVGGGPKAQSVNPPWDILTGSSILKGPSGSFILGRQGKSNHPG
KSESDRMSPGYHADSHDASQSKLYGGLLNPELERYCEDSMKANNQYTGSHLDCFPGMMVP
EMAIKTEQDSDSENGCNIYSMPQNGAWEGNEKPLTMGYSEEPQVKTEDDYYEQYTTCQRN
KTNMSPALNGLHKYLHMAATRTQKDHKTPQADLLGSGQGGSFVDSNAYGSGTVEHKGYMQ
HDNKLNCEFRSHLVHSIKREPIDSPPWPHSGVSQIPLQRNMIPIAMNAIVHKPNPYIYM
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgatgattccacctggagagtgcttgtatgccggaaggaagagaaggaagcccatccaa
aaacataaacagacagcgtccagccagaaaaccaacccctctaagaggcaccgtgaccgt
ctgaatacagagctggaccggctggccagtctcctaccattcaccacagaaatcatctcc
aaactagacaagctgtctgtgcttcgcctcagtgtcagctacctccgatgcaagagcttc
ttccaagccatccaggaggagccatgcgggaagcacatcgcggaactggctggaaaccac
caggataccaagacagagagtgtgcccaatggaacccccaggaccgggggcaacgtggta
gagagtgacctcttactggagtccctgacaggctttgccttggtagtgagcacagatggg
ctgatattctacgcctcgtcctcaattgtggattacctgggctttcatcagacagatgtg
atgcaccagaatgtattcgattatatacatgtggaggacaggcaggacttcagaagacag
ctccactgggcaatgaaccctcggacccagggggcttccctggaccagactgcagccaca
gaagctggtgacgacattgtggtgagcagtctcttcaatggtcaggagcctgacgttgtt
cccctagagctgagctcctttctcacacgctgtttcactgcccgtgtccgctgcctcctg
gacagtgcctcaggtttcctgagcatgcaatttcagggcagcctgaagttcctaccaggc
cagaagaagaagactgagtgtggagcactgctgcccccacagctggctctgttctgtgta
gccatgcccctcatgatgcccactttcacggagctgaagatgaagagcgtggcggtcaaa
agcaagaacaagggctccatcctcaacacactggataagaccagtgacaagagggtccgc
acttctagagactcgtgtgacagcagtggcttcctccttcagaatttgtccactaccact
accagagactcctgccactacaccccatggacgtccctctttaaagacggcatcagaaac
aaggaggatggctactacacccaggtggagcccctcaacttctgtttgtcctctgtgggg
ggtgggcccaaagcccagagcgtgaatcctccatgggacatcctcacaggatcctcaata
ctaaagggcccgagtggcagcttcatcctgggaagacaaggcaagagcaaccacccgggg
aaaagtgaatccgacaggatgtctccaggatatcacgctgacagtcacgacgcctctcag
agcaagctgtacggaggactcctcaatcccgagctggaaagatactgcgaagacagcatg
aaggcaaacaaccagtacacgggcagccatcttgactgtttccctggaatgatggtgccc
gagatggccataaagacagagcaggactctgactcagagaacggttgcaacatctacagc
atgccccagaatggagcctgggagggcaacgagaaacccttgaccatgggctactcagag
gaaccacaggttaagacagaggatgattactatgaacaatacaccacctgccaaaggaac
aaaaccaacatgagcccggctctcaacggactccataagtacttacacatggcagcaacc
aggactcagaaggatcacaagacacctcaagctgaccttttgggtagtggtcagggaggt
agctttgtagacagcaatgcatatgggagtggtactgtggagcataaaggctacatgcag
catgacaacaaactgaactgtgagttcaggagtcatttggtccattccataaagagggaa
ccaatagactcccctccttggcctcatagtggcgttagccaaatacctctgcagagaaac
atgattcccattgcaatgaatgctattgtacacaaaccgaacccatatatctacatgtag

DBGET integrated database retrieval system