KEGG   Esox lucius (northern pike): 105024736
Entry
105024736         CDS       T04894                                 

Gene name
ccnk
Definition
(RefSeq) cyclin-K isoform X1
  KO
K23326  cyclin K
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105024736 (ccnk)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105024736 (ccnk)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PDZ_3
Other DBs
NCBI-GeneID: 105024736
NCBI-ProteinID: XP_028981412
AA seq 563 aa
MKEYRENLIPGNPAASLDHIKPCWYWDKKDLAHTPSQSEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGGCCLFLAGKVEETPKKCKDIIKTA
RSLLNDIQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKDLKYFRSV
SGDKNKVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAVAVMYLAGRLCKFDIQEWTSRQSS
RRWWEQFVQDVPVELLEDICHQILDLYSQGKQQMPQTPSEKTPTTPIPTPQQPLTQQPPL
PSPPVLPPLSKKASPQTSPPRHLKRAHVTSPEEESKAPEPLGSKIPRLEPPMPPPPTSLP
PSDRKRPAPHLSAPLPGDVEQPGAGDPAEAPEGPPPPPHSASLHQPPPLPHRPPPPPPSS
YIMGIPTSSSYMSGEGFQSLQSMMKTEGPSYSAIPPSYGPPLAYHGHVYPTNAPPPPGPP
PPTAYAPPSLPPPSPAYPPPGYNHGYPPPPPPRMPPGHGDYPPGVGIPPSSYPPPPGGQS
QVPPPLPPGMPPIGGMSRGAWMR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaaagaatacagggagaatttgatccctggaaatccagctgcaagtctggatcacatc
aagccatgctggtactgggacaagaaggacctggctcacaccccctcccagtccgagggc
ctagacccggccaccgaggcccggtaccgaagagagggggctcggttcatcttcgacgtg
ggcacgcgcctgggactacactatgacacattggctacagggatcatctacttccatcga
ttctacatgttccattccttcaagcaatttcccagatatgtgaccgggggttgttgtcta
ttcctggccggtaaagtggaagagaccccaaagaaatgcaaagacataatcaagaccgca
cgcagccttctgaacgacatacagtttgcccagtttggagatgacccaaaggaggaggtg
atggtgctggagagaatcctgctgcagaccattaagtttgatctgcaggtggagcaccca
taccagtttttgctccgttacgccaagcagctcaaagatctgaagtatttccgatctgtt
tcaggtgataagaacaaagtccagaagctagttcagatggcctggacatttgtgaatgac
agtctgtgcaccatgctgtcccttcagtgggagccagagatcatagcggtggcagtcatg
tacctggctggccggctgtgtaagttcgacatccaggagtggacgtcccggcagtcttcg
cggcggtggtgggagcagtttgtccaggatgtcccagtggagctgctggaagacatctgc
caccagattctagacctgtactcccagggcaagcagcagatgccgcaaacccccagcgag
aagacccccactacccccatccccaccccccagcagccactcacccagcagcctccgctc
ccaagcccccccgtcctcccaccactcagcaagaaggcctcgccacagaccagccctccc
cgccacctcaaacgagcccacgtgacatctcctgaagaagaaagcaaggcaccagagccg
ctgggctccaagatccctcgactggagcctccgatgcccccaccacccacctcgttacct
ccatcggaccgcaagcgtccagccccccacctgtccgcccctctcccaggagacgtcgag
caaccaggggccggagacccagctgaggccccggaaggacccccgccgcccccgcactcg
gcctctctccaccagcccccacccctgccccaccgccccccgccccctcccccgtccagc
tacatcatgggcatcccgacgtccagctcctacatgtcaggggagggcttccagagcctc
cagtccatgatgaagacggaggggccatcgtacagtgccatccccccgtcctacggccct
cccctggcctaccacggccatgtctaccccaccaacgccccgcccccacccggccccccg
ccccccactgcctacgctccgcccagcctccctccaccgtcacccgcctaccccccgcca
gggtacaaccacggctaccctcccccgccccctccacgtatgcccccggggcacggagac
tacccgcccggggtgggcatcccccctagcagctatcccccgccccctggaggacagagc
caggtaccgcccccgctgccccctgggatgcccccgataggtggcatgagtcggggagct
tggatgaggtga

DBGET integrated database retrieval system