KEGG   Esox lucius (northern pike): 105025189
Entry
105025189         CDS       T04894                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105025189 (adamts13)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     105025189 (adamts13)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   105025189 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 Reprolysin_5 TSP1_CCN TSP1_spondin Reprolysin_2 Peptidase_C50 Peptidase_M10
Other DBs
NCBI-GeneID: 105025189
NCBI-ProteinID: XP_010894007
UniProt: A0A3P8YWS9
AA seq 1542 aa
MAALVLLCLLSVLPCSTATLMRSPLEEQFLHSLNQKDMVFYFGVGSAASVPEFQLFWANC
TTMDHLTGPRPCSSEAHGKRFLLGPGVKNLSLPCRYSVETALNTIVTRKINSMSCQQGNV
LNPPLVRRFLTVCAGKIKGMVVAGAETLYIQPVLHQHMYLTEARRTASPGTPHLVFHQSF
NAKSHPRHSHMKRLPRSRSAMMPEVSHLELLVVVGPDVQLIHRQDTERYILTNLNIASEL
LRDTTLGANIRVHLVRMIILTEDVTETEVNISTNISSSLRSVCDWARRVNPTNDTDPLHA
DLVLYITRFDLELPNGNKQVRGVAQLGGACSSQWSCVITEDTGFDLGITIAHEIGHSFGI
NHDGMGNTCSSSGFMMASDGGYNSVDLTWSPCSRQQLQTFFSEGNADCLKDLPILGGSLQ
DWKPGLYYGVDDQCRIAFGSTARACSFTNTDLPVCRVLSCHIKPGDNRVCKRLLVPLLDG
TECAPNQWCLKGRCVSPNQFSPSSSVVVHGSWSSWSQFSPCSRTCGGGITSRTRQCNNPR
PAFGGNDCKGRDLEAELCHRQLCEKTQLAFMAEQCSKTDFQPLYLSPKKASFYSWIPAVG
FDTGEEQCRYICQSEGENFIVSRGSQFVDGTRCEPNTPASLGSTTACLGGTCQVFGCDGV
LQSGKVEDVCGICGGDGSSCSLTTKSYSGGQAREYVTFLTLPVNATQVQIVNMAPVFTHL
AVLVEDQYVVSGSGSIALNLTHPSPLEDGHLIYRLYLTPDLLPLMEELLLPGPVTKETHI
QVYRKYGKEFGEQTSPNITYKLYTPISNNVLTQQMPRGKWNVVTTSCSVTCGSGIQKPVY
VCVDEGTKEHLEDLYCDSVPSPLPQQAACHLSACPPSWETGEFGPCSASCGGGEALRPVR
CVQRQGARIQQVPASQCSKDSAPQSVDRCNLQPCPTRWTASELGVCSAVCGPGEAKRVVT
CVRSEGGRDVAVDHSLCSGLFKPPVSVACVVDVCPIGWESNREDPLMINNSPDLSSTSRA
VYVWSPVIGRCSKTCGNGTLHVWFSCMEHYSMLGVPEVLCDASRKPLPRTEPCNPFPCPP
TWRYKQGGCSVSCGGGLAHRVLYCSQETMGQEEEVADSTECMNVTKPIALVTCNSFSCPA
RWKVLGTAACSVSCDLGVARRHIACVESIHGLDSEVSEERCPPAIKPATTVPCLAQACTV
KWDVKDWSPCSVSCGYGVQSRAVSCMGPIKPEPLSPLHCMHMAKPITIRGCQMGDCGLMR
KTTLHTHYYSANGPSLESRDQGMEVTPMVESPPVSLTQTPSTVTEMTTPQTDKATPTSTP
KTSPCGQLLLEESGTVDLRHEMGRCILSIGRPLDEVIYIKVESSSLSCKTREYVAFYDRL
VLVRKCGQLKDTELTSRTNVLLVRQNLLSPGNGALLTYSSQKNTKKNHYQDCDVQLFAPS
GVIVNPIVTSQVDSHTCRVFINAPPSVKIRIQALSIGPFVNNTEVQSTFIMIRDVDVLKT
TVFKGQQLFHWQSAGNMAEIEFHGEYLQSNRSFQANYSFIET
NT seq 4629 nt   +upstreamnt  +downstreamnt
atggcagccttggtgctgctctgtctgctgtcagtgctgccatgctccacagcaacacta
atgagatctccacttgaggagcaatttctacactccctgaatcaaaaggatatggtgttt
tattttggtgttggttctgctgcctcagtgcctgagtttcagctcttctgggccaactgt
accaccatggaccacctcactggcccccggccatgctcctctgaggcccatgggaagcgc
tttttgcttggacctggggtgaagaatttgtccctcccctgtcggtactcagtagagaca
gccctaaacaccattgtcacaaggaaaattaattccatgtcttgtcagcagggaaacgtt
cttaatccgcctttagttagaagatttcttaccgtctgtgctgggaaaatcaaaggcatg
gtggttgcaggggccgagacactatacattcagccagtgctccatcagcacatgtatctg
actgaagccaggagaactgccagcccaggaacaccccacctggtgttccaccagtccttt
aatgccaaaagccaccccagacactctcacatgaagaggttgcctcgcagtcggtcggcc
atgatgcccgaggtgtcccacctagagctactagtggtagtggggcctgacgtccagctg
atccatagacaggacacagagagatacatcctcaccaacctcaacattgcctcagagctt
ctgagggacacgacgctgggtgccaacataagagtgcatctggtccgcatgatcatcctc
acagaggatgtcacagagacggaggtcaacatctccaccaacatctcctcatccctgagg
agtgtgtgtgattgggccagaagagtcaacccgactaacgacacagaccccttgcatgct
gaccttgtgctgtacataacaagatttgaccttgagctgccaaatggaaacaagcaggtg
aggggtgtggcccagctaggcggggcttgctctagccagtggagctgtgtgatcacagag
gacacaggttttgatctgggcatcacaatcgctcatgagataggccacagttttggtata
aaccacgatgggatgggcaacacgtgcagcagcagtggctttatgatggcctctgatgga
ggctacaacagtgtggatctgacctggtctccgtgcagtagacagcagctgcagacattc
ttcagtgaaggcaatgctgactgtctgaaagacttgcccattctgggaggatctctgcaa
gactggaagccaggcctttactatggagtggatgaccagtgtcgcatagcgtttgggagc
actgccagagcctgctctttcaccaacactgacctgcctgtatgccgtgttctttcctgc
cacatcaaaccgggggacaaccgtgtctgcaaacgcctgctggtgcctctgttggatggg
acagaatgtgcacccaaccagtggtgcctaaagggtcgctgcgtgtccccaaaccagttc
agtccttcttcctctgtggtggtgcatggctcctggtccagctggtcccagttctccccc
tgctcacggacatgtggcggtggcatcacctcgcggaccaggcaatgcaacaaccctcga
cctgcatttggtgggaatgattgcaagggtagagatttggaggctgaactttgtcaccgg
cagctgtgtgagaagacccagctggccttcatggcagagcagtgctcaaagacggatttc
caacccctgtacctgtcccccaaaaaggcctctttctacagctggatccccgctgtgggc
tttgacacaggggaagaacagtgcaggtacatctgccagtctgagggagaaaacttcatt
gtgagtcgtggctctcagtttgtggatgggactcggtgcgaacccaacactccagcttcc
ctcggctccactacagcttgtcttggagggacgtgccaggtgtttggctgtgatggagtg
ttgcagtctgggaaggtggaggatgtgtgtgggatatgtggaggagatggctcctcctgc
agtctcaccactaagtcttacagtggaggtcaggccagagagtatgtcacattcctgacc
ctgccagtgaatgctactcaggttcaaattgtcaacatggcacctgtcttcactcatctt
gctgtgttggttgaagatcaatatgttgtgtctggaagtggcagcatcgcattaaacctc
actcacccctctcctctggaggatggtcatctgatttatcggctctatcttacccctgac
ctcctacctctcatggaggaactactgctgcctggacctgttacaaaggaaacacacata
caggtctatcggaaatatggaaaagaatttggagagcaaactagtccaaacatcacatac
aaattatacacacccatcagcaataatgttcttacacaacagatgcccaggggcaagtgg
aatgttgttacaacctcctgctcagtcacctgtggctcaggcatacagaaacctgtgtat
gtttgtgtggacgaaggcactaaggaacatctggaggacttatactgtgactcagttccc
agtccccttcctcaacaggcagcctgtcacctttccgcttgtccacccagctgggagacg
ggagagtttgggccctgcagtgcttcgtgtggtggtggagaggcactacgtcctgtgaga
tgtgtccagaggcaaggagctagaatccaacaggtgccggcttctcagtgttcaaaagac
tcagctccacagtcagtggatagatgcaaccttcaaccctgccccacaaggtggactgcg
tcagaactcggggtgtgttcagcggtctgtgggccaggagaggccaaacgtgttgtgaca
tgtgtgcggtccgaagggggtcgcgatgttgcggtcgaccacagcttgtgttctgggctc
ttcaaaccccccgtgtcggtggcctgcgtggtggatgtctgtcccatcggatgggagtcc
aacagagaggatccactaatgatcaacaactcccctgatctgagctccacaagccgcgca
gtgtacgtgtggagtcctgtgattggccgatgctcgaagacctgtgggaatggaaccctg
cacgtgtggttctcttgcatggagcactacagcatgctgggggtgcctgaggttctctgt
gatgcgtccaggaaaccgctgccacgcacggaaccctgcaaccctttcccatgccctcct
acgtggcgctacaagcagggagggtgcagtgtgtcgtgcggtggaggcttggcccacagg
gttctctactgctcccaggagaccatgggacaggaggaagaggttgcagacagtacagag
tgtatgaacgtgaccaaacccatagcgctggtcacatgcaactccttcagctgtccagcc
aggtggaaagtgctggggacggcggcctgttctgtctcttgcgacctgggggtagccagg
aggcatatagcctgtgttgagtcaatccacggactggacagcgaggtctctgaggagagg
tgccctccagccattaagcctgccaccacggtgccatgtctggcgcaggcgtgcaccgta
aaatgggacgttaaagactggagtccgtgttctgtgtcctgtgggtatggggtccagtcc
agagcagtgtcttgcatgggacccatcaagccggagcccctcagcccactacactgcatg
cacatggctaagcccatcactatccggggctgccagatgggtgactgcgggctcatgagg
aagactacactccacacccactactacagtgccaatgggccctcactggagagcagggac
cagggcatggaggtcactcccatggtggagtctccacctgtcagcctgacccagacacct
tccactgtaacagagatgaccaccccacagactgacaaagccacgcccacctccacccca
aaaaccagtccatgtggacagcttctgctagaagagtctggcacagtggacttgagacat
gagatgggtcgctgcatcctgtctataggccggcccctggatgaggtcatctacatcaaa
gtagagtccagctccttaagctgcaaaacaagggagtatgtggcgttctatgatcgactg
gtactggtcaggaagtgtgggcagttaaaggacactgaactgacctccaggactaatgtg
ctgctggtaaggcagaatctcctatcaccaggaaatggagcactgctcacttacagcagt
cagaagaacaccaagaaaaatcattatcaggactgtgatgtccagctgttcgctcccagt
ggggtcattgtgaatccaatagtgacttcacaggtggacagtcatacgtgccgggtgttc
atcaatgcccctccttcagtaaagatcaggatccaggctctgagcattggccctttcgtc
aacaacacagaagtccagtccacttttattatgatacgggatgtggatgttttgaaaacc
acagtgttcaagggccaacagctttttcactggcaatctgctggaaatatggcggagatt
gaattccatggcgagtacctgcaaagcaacagaagtttccaagctaattactcatttata
gagacttga

DBGET integrated database retrieval system