KEGG   Esox lucius (northern pike): 105025393
Entry
105025393         CDS       T04894                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105025393
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105025393
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105025393
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 105025393
NCBI-ProteinID: XP_010894334
AA seq 953 aa
MTMCSLLVLVLLLELLAPSLGAQLPEGHNEEDNVSSPPPIATNGQPFPWDQMRLPETVSP
VHYYLLIHPNLTSLDFTGAVRIEVQVHKDTSTIILHSKALQIAKAELLAPEGPGSLPIPL
QVLEYPAFHQLALVSNVLLVSGWVYEVRLEFSANLSDSFHGFYKSSYRTTSGELRFLAST
QFEATSARAAFPCFDEPAFKANYTIQIRREARHIALSNMPKVKTVELPGGLLEDHFDTSV
KMSTYLVAFIVSDFLSVSKTTSHGVKISVYAVPDKIDQTEFALNAAVKLLDFYDDYFDIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESGLLFDSSKSSASDKLGITMVIAHELAHQWF
GNLVTMQWWNDLWLNEGFAKFMEFVSVNITNPELQVNDFFLGKCFEAMEVDSLSSSHPVS
SQVETPSQIQEMFDDVSYDKGACILHMLRDFLTPEAFKIGIVRYLRRYSYQNTVNTHLWD
SLTNICQSDDLDEGRLKEEFCSRGKAQSGAQKWFSGDQLDVRAIMDTWTLQEGFPLVTVE
LRGRQVRLSQERYLKTHDPSQKEGFLWQVPLTYITSSSNTVHRFLLQTKTDVLYLPEEVV
WVKFNVDMSGYYMVHYEGDGWPSLTSLLLTNHTALSSNDRASLINNVFQLVSVGKVGLDT
ALDLSLYLSKETEIMPVTQGLGELVPLYKLMEKRDMVALENQMKDFIVDLFRDLIDRQTW
TDEGSVSERMLRSYLLLFGSVRNHPPCVANATQLFKKWRASDGNMSLPSDISLAVFAMGA
RDPEGWDFLFEKYRHSLHTSVKSRIKSALSISPLQHKLQSLMEQSLGGEVMKTQDLPHVV
ISVSRNPKGYKLAWDFLRHNWHTLIKKFDLGSHSVSGMVTGVTNQYSTREMLDEVRGFFG
SLSEETGAGLRCIQQTYESIEENIRWMDQHLPRLQAWLDIHGPRPKPQPHEDL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgactatgtgcagcctgttggtcctggtgctcctattggagcttcttgcaccatctttg
ggggcacagttaccagaaggccacaatgaagaggacaatgtttcctctccacctcccatc
gccactaatggtcaaccgttcccatgggaccagatgagacttcccgaaaccgtttctcca
gtccactactatctccttattcaccctaatctaactagccttgactttactggagctgtg
cgaattgaagtccaagtccataaggacacctctacaatcattcttcacagcaaggcgctc
cagattgccaaagctgagctcttggcaccggaaggtccagggtcactgccaatacctctc
caggtgttggaataccccgcctttcaccagttggctctggtttccaatgtgcttctggtc
agtggttgggtgtatgaggttcgtctggagttttctgctaacctgtctgacagtttccat
gggttttataagagctcctatcgcacaaccagtggagagctcaggtttctggcatccacc
cagtttgaagccaccagtgctcgagcagccttcccctgttttgatgagccggcatttaaa
gccaactacaccatccagatacggcgggaagcacgccacatagccctctccaacatgccc
aaggtaaagactgtagagctgccaggcggtcttctagaggaccactttgataccagcgtc
aagatgagtacttacctggtagccttcattgtttctgacttcctgtccgtcagcaagacc
accagtcatggcgtcaagatctcagtatacgctgtaccggacaagatcgaccagacagag
tttgcgctgaacgccgctgtcaaactgctggacttctatgatgactactttgacatcccg
tatcctctacccaaacaggacctggcagctatcccagacttccagtcaggtgcgatggag
aactggggtctgacaacctaccgagagtctgggcttctgtttgactccagcaagagctct
gcctctgacaagcttggcatcaccatggtgattgcacatgagctggcacaccagtggttt
ggtaacctagtaaccatgcagtggtggaacgacctgtggctcaacgagggcttcgccaag
ttcatggagtttgtgtctgtcaacatcaccaaccctgagttacaagtgaacgacttcttc
ttggggaagtgttttgaggcgatggaagtggattcactaagctcctcccatcctgtgtcc
agtcaggtggaaacaccgtcccaaatccaggagatgttcgacgatgtctcctacgacaag
ggggcatgtatcctacatatgctgagagacttcctgactcctgaagcctttaagatcgga
atcgtccgctaccttagacgctacagctaccagaacacggtcaacacccatctgtgggat
agcctcaccaacatctgccagtctgatgatctggatgaggggagactgaaggaagagttc
tgttcccggggtaaggcccagtccggagcccagaagtggttctctggtgaccagctggac
gtcagggctatcatggacacatggacgctacaggagggctttcctctggtcaccgtggag
ctcaggggtcgccaggtcagactcagccaggagagataccttaaaactcacgacccctcc
cagaaagaagggttcctttggcaggttcctttaacttacatcaccagctcttctaacaca
gtacatcgcttcctgcttcaaaccaagactgatgttttgtacctgccggaagaggtggtc
tgggtgaagttcaatgtcgacatgagtggttactatatggtccattacgagggggatggc
tggccctccctgacctccctgctgttgaccaatcacacggctctgagctccaacgaccgt
gcctccctcattaacaacgtcttccaactggtcagcgtgggcaaggtgggactcgatact
gcacttgacctgtccctctacctgtccaaggagacggagatcatgccggtcactcagggc
ctgggggagctggttcctctctataaactgatggagaagagggacatggtggccctggag
aaccagatgaaggacttcatcgtggatcttttccgggatttgatcgaccgtcagacgtgg
acggacgagggttctgtatcggagcggatgctgaggagctacctgctgctgtttggttct
gtccggaaccacccaccctgtgtcgccaacgcaacacaactcttcaaaaaatggagggcc
tcagatggcaacatgagtctccccagcgacatcagcttagcggtgtttgccatgggtgct
cgtgaccccgaggggtgggacttcctctttgagaagtaccgccattcgctgcacacgtct
gtcaagagccgcatcaagtctgccctttccatcagcccactgcaacacaagctgcagagt
ttgatggagcagagtttggggggtgaggtgatgaagactcaggaccttcctcacgtggtc
atctccgtcagcaggaaccccaaaggttacaagctagcctgggacttcctcagacataac
tggcacaccctgataaagaagtttgacctcgggtcccattctgtctctggcatggtgact
ggagtgaccaaccagtactccaccagggagatgctggatgaggtgcgtggcttctttggc
tcactgtctgaggagactggagctggtctcaggtgtatccagcagacctatgagagcatt
gaggagaacatccgttggatggaccagcacctgcccagactacaggcctggctggacata
catggccccaggcccaagccacaaccccatgaggatctgtag

DBGET integrated database retrieval system