KEGG   Esox lucius (northern pike): 105025705Help
Entry
105025705         CDS       T04894                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
els  Esox lucius (northern pike)
Pathway
els00232  Caffeine metabolism
els00983  Drug metabolism - other enzymes
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    105025705
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    105025705
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     105025705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Phageshock_PspD
Motif
Other DBs
NCBI-GeneID: 105025705
NCBI-ProteinID: XP_010894887
AA seq 290 aa AA seqDB search
MNLEEYFKRIGFLGEFSKPDLETLNQVHKHHVMSVPFENLSIHCGEKITMDLEVIFNKIV
RSNRGGWCCENNLLFSWVLKEMGYSPVMLGSRVYNNTTNQFNPMDSHLINKVIINGTAYI
ADVSFGVSSQIWYPLELVSGKDQPQSPGVFRLIQDGELWTLEKTARKPLVLNNAFANSPL
VNKCLKKKIYGFTLHPRGVDHFLETSHCLQTDPNSLFTNKSICSLQTAIGFRALIGWTFI
EATYNDQDGVDVLDLKNIPDDDVDKVLKEIFNLSLANKLVTKNNKADYTV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggaagagtatttcaagaggattggtttccttggagaattttctaaaccagac
cttgaaacactaaaccaggtccataaacaccatgtgatgtcagttccatttgaaaacctc
agcattcactgtggtgagaagatcactatggatcttgaagtcattttcaataagattgtg
aggagcaaccgtggaggttggtgttgtgagaataatctcctcttttcctgggtgctaaaa
gagatgggttatagtccagtgatgttgggttcaagagtctacaacaacaccacaaaccag
tttaatcccatggactctcacctcatcaacaaggtaatcattaatgggacagcttacatt
gcagatgtgagctttggcgtatcctcccaaatatggtaccctcttgagcttgtctcgggg
aaggaccagccacaatccccgggtgtcttccgtctgatacaagatggagaactgtggact
ttggagaagacagctcgaaagcctctggttctcaataatgcttttgccaactcacctctg
gtaaacaagtgcctaaagaagaagatctatggcttcaccttacatccacgtggggttgat
catttcctagagacttcccattgccttcagacagatccaaattctctgttcaccaacaag
tccatctgctcattgcagacggctataggattcagagccctaattggctggaccttcatt
gaggccacctacaacgaccaggatggtgttgatgttctggatctgaaaaacatacctgat
gacgatgtggataaagtgctgaaagaaatctttaacttgtcgttggcaaacaagctggtt
actaaaaacaacaaagctgattacactgtttaa

DBGET integrated database retrieval system