KEGG   Esox lucius (northern pike): 105025929
Entry
105025929         CDS       T04894                                 

Gene name
btaf1
Definition
(RefSeq) TATA-binding protein-associated factor 172
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105025929 (btaf1)
Enzymes [BR:els01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     105025929 (btaf1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105025929 (btaf1)
SSDB
Motif
Pfam: DUF3535 SNF2_N HEAT Helicase_C Vac14_Fab1_bd HEAT_2 HEAT_EZ
Other DBs
NCBI-GeneID: 105025929
NCBI-ProteinID: XP_010895297
AA seq 1862 aa
MAVSRLDRLFILLDTGTTPVTRKAAAQQLGDVVKLHPHELNNLLSKVLTYLRSPNWDTRI
AAGQAVEAIVNNIPEWNPSPKHKEECCADFSPEDSSCDRLSFQNFDISRLLKHGASLLGS
AGVEFEVQDDKSGEVDPKERLARQRKLLQRKLGLDMGAAIGMDTMELFNDDDLDAQYTCP
ASGPKTQDHGGKSSGPCSSSRNNAPMQAAEIIDSEFRPGMSNRQKNKAKRMAKLVAKQRS
RDMDPNERSNDSVEGEPEEKRRKTTNVVIDQPATEHKVLIDNILDNSSLLEDTQEWPLES
FCDELCNDLFNPSWEIRHGAGTGLREILKSQGAGGGKLVGFTTEQMARQHQEWLEDVVIR
LLCVFALDRFGDFVSDEVVAPVRETCAQTLGVALRHMTESGVTMTVDILLKLLIEDQWEV
RHGGLLGIKYALAVRQDLISALLPRVLPAITEGLQDLDDDVRAVAAAALIPVVDGLVQLL
PNEVPFIVNSLWDALLELDDLTSSTNSIMTLLSSLLTYPQVRQCSMQQSLTVLVPRVWPF
LRHTISSVRRAALETLFTLLSKADQSCALWLNQVLQDMLRHIFQSCILESNQEILDLIQK
VWAELLRQAPQQYVVAASCPWMGAWLCLMMQASHIPIDINMLLEVKARCKEKVGGKPRQG
AAVPVKETVQEYIAGAETVTEDPVTRDYVVTRARLMAARLLGALCRCICDPQLNSLSQDI
RPAESLGQLLLFHLNSKSALQRIAVALVLCEWAALQKECRVVSAMVQPRLLAILSEQLYY
DEIAIPFTRMQNECKQLIALLADAHIDVCDRLNCNVFTIDQANELVTTVFAESTTGLNMK
SKPFQPLDSKRQQAQSTVAETSVEWQQLHLRVHMFTACAVVNLQALPDKLNPVVRPLMEA
AKREENTLVQGYAASFIAKLLQQCASRQPCPNSKIVKNLCTSVCVDPLLTPSSSSPISPT
QETSKAGVSEKECMHHMVNKTKGIITLYRHQRAAFAITSKRGPAPKTPKTPTAELPPGST
ITVDSDENKKPCLVQRRGAEFCLMTVARHFGQELTVSLPYLWESVVGPLRAVVGDNQSID
GKLQLERGDAVAQELVNSLQVLEVIAGAMAPELKPLLLDRLASLFTCLQHPYTAVRHMAA
RCVGVLSKIATMETMHLFLERVLPWLGCIGDSTKQEGAMEAMACVIEQLDVDIVPYIVLL
VVPVLGRMSDPSDSVRFMATQCFATLIRLLPLEAGIPDPPTMSDDLIRQKARERHFLEQL
LDGRKLENYKIPVPIKAELRKYQQDGVNWLSFLNKYKLHGILCDDMGLGKTLQSICILAG
DHYLRAQEYARTKAADCSPMPSLVVCPPTLTGHWVDEVGKFCTKDYLNPLHYTGPPTERA
RLQHLVKKHNLVVASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAIKQLAANF
RIILSGTPIQNNVLELWSLFDFLMPGFLGTERQFAARYGKPILASRDAKSSSREQEAGVL
AMEALHRQVLPFLLRRMKKDVLQDLPPKIIQDYYCNLSPLQVQLYEDFAKSRAKVSVEDT
ISTASTEEEEKPKLKATGHVFQALQYLRKLCNHPGLVLLPQHPEYKRITEQLAAQHSSLR
DIQHSPKLSALKQLLLDCGLGGGGSAEGTEAVVAQHRVLIFCQLKSMLDIVEHDLLKPQM
PTVTYLRLDGSVQAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWN
PMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQENASLQSM
GTDQLLNLFTLDKDGKVDQGESSSSSGSKASIKNVLDDLGDLWDQQQYDTEYNLDSFMHS
LH
NT seq 5589 nt   +upstreamnt  +downstreamnt
atggccgtatcaaggcttgatcgcctgttcatcctgcttgacactggaactactccagtt
acaaggaaggctgccgcccagcagctgggcgatgtggtaaaactccacccacatgagctc
aacaaccttttgtcgaaggtgttgacatacctgcgaagtcccaactgggatacgcgcatt
gctgcgggtcaggcagtggaggccattgtaaacaatatcccagagtggaacccgtcaccc
aagcacaaagaagagtgttgtgcagacttctccccagaggactcctcctgtgaccgtttg
agttttcagaattttgacatctcccgcctgctcaaacacggcgcttctctgctgggttcc
gctggcgtggagtttgaagtacaggatgacaagtccggtgaggtggatcctaaggagcgc
ctggcccgccagaggaagctgctgcaaaggaagctgggtctggacatgggcgctgccatc
ggcatggacaccatggagctgttcaatgatgacgacctggacgcccagtacacctgccca
gccagtggccccaagacccaggaccacggagggaagagctctggaccctgctccagctcc
cgcaacaatgcgcccatgcaagcggctgagataatcgactctgagtttcggccgggcatg
agcaaccgacagaagaacaaagctaagaggatggccaagctggtggccaagcaacgatcc
agggacatggatcccaacgagagaagtaatgacagtgttgagggagaacctgaggagaag
cgcaggaaaacgacgaatgtagtcattgaccaaccggcaacggagcataaagtcttaatc
gataacattctggacaactccagcctcttagaggatacccaggagtggcctttggagagc
ttctgcgatgagctctgcaatgacctctttaacccctcatgggagatacggcacggtgca
ggcacaggcctccgggagatcctgaagtcccaaggggctggaggagggaaattggtggga
ttcaccacagaacagatggctcggcagcaccaggagtggctggaggatgtggtcatccgg
ctgctttgtgtctttgccctggatcgtttcggagatttcgtgtccgacgaggtggtggct
ccggttagagagacctgtgcccaaacactgggtgtggccctacgtcacatgactgagagc
ggcgtcaccatgactgtagacatcctgctgaagctgctgattgaggaccagtgggaggtc
cgccacgggggtcttctgggtatcaagtacgccttggctgtcagacaggacctgatctct
gctctgcttcctcgggtgctgcctgccatcacagagggtctgcaggatttggatgatgat
gtcagagcagtggcggctgcagccctgatcccagtggtggatggcttggtgcagcttctc
cccaatgaggtcccattcatagtgaactccctgtgggacgcactcctggagctggatgac
ctgacatcgtccaccaacagcatcatgaccctcctgtcctccctgctcacctatcctcag
gttcgccagtgcagcatgcagcagtctctgacagtccttgtccctcgggtctggcccttc
ctccgacacaccatatcgtccgtcagacgggcggcgctggaaactctcttcaccctgctg
tccaaagctgaccagagctgtgccttatggctcaaccaggtcctgcaagacatgctccgc
cacatcttccagtcctgcatcctagagagcaatcaggagatcctggacctcatccaaaag
gtgtgggccgaactcctgcgccaagccccccagcagtacgttgtggctgccagctgtccc
tggatgggtgcctggctctgtctgatgatgcaggcctctcacattcccatcgacattaac
atgctgctggaagtcaaggctcgctgcaaggagaaggttgggggcaagcctcgccaggga
gcggcggtgccggtgaaggagaccgttcaggagtacatcgcaggggctgaaaccgtgact
gaggaccctgtgacgagggactatgtggtgacacgggctcgactcatggccgccagactg
ttgggggccctgtgtcgttgtatttgcgacccgcaactcaactcgttgtcccaggacatc
cggccggctgagtctctgggccagctgctgctttttcacctcaattccaagtctgccctg
cagcgtatcgctgtggccctggttctttgtgagtgggctgcgctgcagaaggagtgtcgg
gtggtgtcggccatggtccagcctcgccttttggctatcctatcagagcagctgtactac
gacgagattgccattcccttcacgcgcatgcagaacgagtgcaagcagctcatcgccctg
ctggccgacgctcatattgatgtgtgcgaccgcctcaattgcaacgtgttcaccatcgac
caggctaacgaactggtgaccaccgtcttcgcagagtccactacaggtctgaacatgaag
tctaagccgtttcagccactggacagcaagcggcagcaggcccagtcgacggtggctgag
accagcgtggagtggcaacagctgcacttgcgcgtccacatgttcaccgcctgcgccgtg
gtcaacctacaggcactgccagacaagctgaacccggtggtacgtccgctgatggaggca
gccaagcgggaggagaacacccttgtccagggctacgccgcctccttcatcgccaagctg
ctgcagcagtgcgccagcaggcagccatgtcccaactccaagatcgtcaagaacctctgc
acgtcggtctgcgtggaccccctgctcacgccctcctcttccagccccatatcgccaact
caggagacttctaaagccggcgtatcggagaaagaatgcatgcaccacatggtcaacaag
accaagggcatcatcactctgtaccgccaccagagggcagcattcgccatcactagcaag
aggggccctgcccccaaaactcccaagacccccaccgctgaacttccccctggtagcacc
attactgtagatagcgatgagaataaaaagccatgcctcgtccagagaagaggggctgag
ttctgcctgatgacggttgccaggcactttggccaagagctgactgtgtcgctgccctac
ctgtgggagtctgtggtgggacccctgagggctgtggtcggagacaatcaaagcatcgat
gggaagctccagttggagaggggggacgctgtagctcaggagctggtcaactctctgcag
gtgctggaggtcattgctggggccatggcccctgagctcaaacctctgctgttggaccga
ctagcctccctgttcacgtgtctgcagcacccctatacggccgtgcgtcacatggcggcc
cgctgcgtgggcgtgctcagtaagattgctaccatggagaccatgcacctgttcctggag
cgtgtgctgccctggctggggtgcatcggggacagcaccaagcaagagggggctatggag
gccatggcttgcgtgatcgaacaactggacgtggacatcgtgccgtacatcgtgctgctg
gttgtgcctgtgctcggtcggatgagcgaccccagcgacagcgtccgcttcatggccacg
cagtgcttcgccaccctcatccgcttactgccgctggaggcgggtatcccggaccctcca
accatgtcggatgatctgattcgccagaaggccagagagcgccacttcttagaacagctg
ctggacggcaggaagctggagaactacaagatccctgttcctatcaaagctgagctccgc
aagtatcagcaggatggagtgaactggctgtccttcctgaacaagtacaagctgcacggc
atcctgtgtgacgacatgggcctggggaagaccttgcagtccatctgcatcctggcaggt
gaccactacctcagggcccaggagtacgccagaaccaaggctgcagactgcagccccatg
ccttctctggtggtgtgtccccccaccctcacgggtcactgggtcgacgaggtgggcaag
ttctgcaccaaggactacctgaaccccctgcactacaccggaccccccacggagagagcc
cggttacagcatctagtgaaaaagcataacttagtagtagcctcttacgatgttgtacgg
aacgacattgacttttttaggaatataaaattcaattactgtatcctggacgaaggtcat
gtgatcaagaatgggaagaccaagctctccaaagccatcaagcagttggctgcgaatttc
cgtattatcctatcaggaactcctatccagaataacgttctggagctgtggtcgctcttt
gacttcctcatgcctggcttcctgggcacggagcgtcagtttgccgcccgttacggaaag
cccatcttagccagccgggatgccaagagctcatcacgtgagcaggaggctggtgtgttg
gctatggaggcactgcatcgccaggtcctgcctttcctcctgaggaggatgaagaaggat
gttctgcaggatctccccccaaagatcatccaggattactactgcaacctaagccctctg
caggttcagctctatgaagattttgctaagtcacgggctaaggtcagcgtggaggacaca
atttccaccgcctccaccgaggaggaggaaaagcccaagctgaaggccacaggccatgtg
ttccaggctctgcagtacttaaggaagctgtgtaaccaccccgggctggtcctgcttccc
cagcacccagagtacaagcgcatcacagagcagctggccgcacaacactccagccttcga
gacatccagcactcccccaaactgtcagccctgaaacagttgctgctggactgtggcctg
gggggcgggggctctgctgagggcaccgaggcggtggtggcccagcaccgagttctgatc
ttctgtcagctgaagagcatgctggacattgtggagcatgacctgctgaaaccccagatg
cccacggtcacctacctgcgactggacggcagcgtgcaggctggcctgcgtcactccatc
gtctccaggtttaacaacgacccatccatagacgttctgctcctgaccactcatgtgggg
ggcctgggtctgaacttgactggcgccgacaccgtggtgtttgtggaacatgactggaac
ccaatgagagaccttcaggccatggaccgtgcccaccgaatcggacagaaacgcgtggtg
aacgtttatcgactgatcacgcggggcaccctggaggagaagatcatgggcctgcagaag
ttcaagatgagcatcgccaacactgtcatcagccaggagaatgccagccttcagagcatg
ggcactgaccagctcctcaacctctttaccctggacaaggacgggaaggtggatcagggc
gagtcgtcatcgtcgtctggaagtaaagcgtctataaagaacgttctggatgatctcggc
gacctgtgggaccagcagcaatatgatacggagtacaacctggacagcttcatgcactcg
ctccactag

DBGET integrated database retrieval system