KEGG   Esox lucius (northern pike): 105026538
Entry
105026538         CDS       T04894                                 

Definition
(RefSeq) carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform X2
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105026538
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105026538
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105026538
Protein phosphatases and associated proteins [BR:els01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   105026538
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105026538
SSDB
Motif
Pfam: NIF
Other DBs
NCBI-GeneID: 105026538
NCBI-ProteinID: XP_010896353
UniProt: A0A3P8ZVN8
AA seq 263 aa
MDNSSSIITQVTRDEEDNSTLREEGAPACVVSSKKPRSQGIFQSLFCCVCHQEPEQIPVN
NNVPVLVEENGTISKVPAKPLLPQIKSKDSGKICVVLDLDETLVHSSFKPVNNADFIIPV
EIDGTVHQVYVLKRPHVDEYLKRMGELFECVLFTASLSKYADPVSDLLDKWGAFRHRLFR
ESCVFHRGNYVKDLSRLGRELNKVVIVDNSPASYIFHPDNAVPVASWFDDMADTELLDLI
PFFERLSKVDDVYDILKQQRTAS
NT seq 792 nt   +upstreamnt  +downstreamnt
atggacaattcgtcctcaataatcacgcaagtaacaagagatgaagaagataactctact
ttgcgcgaggaaggagcacctgcctgtgtcgtttcatcgaagaagccacgtagtcaaggt
atttttcaaagtctcttctgctgcgtctgccaccaagaacctgagcaaatcccagtcaac
aacaatgtccccgtattggtggaagaaaatgggaccatttcaaaagtcccagcaaaacct
ctgcttccacaaatcaagtcaaaagactcagggaagatctgtgtggtactagatttggat
gaaacattagtgcacagttccttcaagcctgttaacaatgccgattttatcattccagtg
gaaattgatggaacagttcaccaggtgtacgtgttgaagcgaccccatgtggatgagtat
ctcaaaagaatgggggagttgtttgaatgtgttttgttcactgccagtttatccaagtat
gccgatcccgtctctgacctgctggataaatggggtgcttttcgacatcgcctctttcgg
gagtcctgcgtattccaccgaggaaactatgtaaaagacctgagtcgtctgggcagggag
ctcaacaaggtcgtcatcgtagacaactccccagcctcctacatctttcaccctgataat
gctgtccctgtagcatcctggtttgacgacatggcagacacagagctcctagatctcatc
ccattcttcgaaagacttagcaaagtggatgatgtctatgatattctaaagcagcagagg
actgcaagctaa

DBGET integrated database retrieval system