KEGG   Esox lucius (northern pike): 105026590
Entry
105026590         CDS       T04894                                 

Definition
(RefSeq) cysteine/serine-rich nuclear protein 1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105026590
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105026590
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105026590
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105026590
SSDB
Motif
Pfam: CSRNP_N YqfD
Other DBs
NCBI-GeneID: 105026590
NCBI-ProteinID: XP_010896439
UniProt: A0A3P8ZFL3
AA seq 611 aa
MLASGIMSGLLKRKFEEVYKDDPCYSSSSLSSSAYSGWDSEGESCYSDSLDSTPSNPGSP
DTQCHTTSILKNGKRVRCGRGNVTFDMVTVFLFPRCQGFSSVPSRGGCSLGMVQKHSSLR
RYTLTEYAVAQRTLRKEKLLTRLREEKLEALKQKLTKGGTVMSEEADRLTLEDIPEVQVD
ISGCNLDSSSFLQPYPSRRRHALLKAAGVKKIDKEEKRELHELRVSREDCGCDCQGFCEP
ETCACSLAGIKCQMDHSTFPCGCTKDGCGNTEGRIEFNSSRVQTHYIHTIMKLELEKRLE
ETSGPGYAPSGSTHNSLADLPSITDGPSFHFSSELAAVGENSCGSDMTDSSSSSRGSDDS
QEGVGLERDSQEGGSLLDVDENGLRRILRFSEVDNDNYNINNHVVNDNRCFPNQTLQQPS
STSVLGFSMDDFPDENDNGEPSSTSVLGFSTADFPDENDNVESALLQERKDLHTTPVSEL
LDYSANEANGLFHHHEANPPSPFVERPNTPSPSTDRTAASYMDLSLSSESDLEFFDGFPC
LGPSSLYSSLKDYEHMDNFFQFQLPSYPSSHSLASDPGTCLLESLIGLSESIPEPPATFT
DNQLLEEAVRG
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgctagctagcggcatcatgagtggacttctgaagaggaagtttgaggaggtgtacaag
gacgacccgtgttactcctcctcctccctgtcctcctcagcctactccggctgggactcg
gagggggagagctgttactcggactccttggactcgacgcccagcaaccctggttctcca
gacacacagtgccacaccacctcaatcctgaagaatggcaagcgtgtgcggtgtgggagg
ggcaacgtgacctttgacatggtgacggtgttcctctttccgcggtgccagggcttcagc
agcgtgcccagcagaggaggctgttccctgggcatggtgcagaagcacagctctctacgc
agatacaccctgacagagtatgctgtggcgcaacgcaccctccgcaaagaaaaactactc
acccgcctccgtgaggaaaaactggaagccttgaagcagaagctaaccaagggaggtaca
gtgatgtcagaggaggctgaccgcctcaccctggaggacataccagaggtccaggtggac
atcagtggctgtaacctggacagcagctccttcctccagccctacccctccagacggaga
cacgcccttctgaaagctgcaggggtgaagaagattgataaggaggagaagagggagctc
catgaactcagggtgtcccgagaggactgtggctgtgactgccaggggttctgtgagcct
gagacctgtgcctgcagcctggctggaatcaagtgtcagatggaccactccacgtttccc
tgcggctgcaccaaggatggctgtggcaacactgagggtcgtatagagttcaactccagc
cgagttcagactcactatattcacaccatcatgaagctggaactagagaagaggctggaa
gagacgtctggcccaggctacgccccctcaggctccacccacaactccctggctgacctg
ccctccatcaccgatggcccgtccttccacttcagctcggagctggcggcggttggggag
aacagctgtggtagtgatatgactgactcctcttcctcctcccgggggagtgatgactcc
caggagggggtggggttagagagggactcccaggagggtggctccctgctggacgtggac
gagaatggactgaggcgtatccttcgcttcagcgaggtcgacaacgacaactacaacata
aacaaccacgttgtcaacgacaaccgctgcttccccaaccaaacgctacagcagccgtcg
tccacgtctgtgttggggtttagcatggatgacttcccggatgagaatgacaatggggag
ccgtcgtccacgtctgtgttggggtttagcacggctgacttcccggatgagaatgacaat
gtggagtcagcgctgttgcaggaacggaaagacctccacaccacgcctgtgtcagaacta
ttagactacagtgctaacgaagccaacggtctgttccatcaccatgaagctaacccccct
tccccctttgtagaacgtcccaacaccccctccccctccactgaccgcaccgccgccagt
tacatggacctcagcctgtcatcggagtcagacctggagttcttcgatggctttccgtgt
ctggggccctcgtctctctacagctccctaaaagactacgaacacatggacaacttcttc
cagtttcagttgcctagttaccccagcagccactccctagccagcgaccccgggacctgt
ctcctagagtctctgattggtctgtccgaatctatcccagaacctcccgcaacgttcaca
gacaatcagctgttggaggaagccgtcaggggttag

DBGET integrated database retrieval system