KEGG   Esox lucius (northern pike): 105027270
Entry
105027270         CDS       T04894                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els00240  Pyrimidine metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105027270 (dck)
   00240 Pyrimidine metabolism
    105027270 (dck)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     105027270 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 105027270
NCBI-ProteinID: NP_001291054
UniProt: C1BYR9
AA seq 264 aa
MLLAPPKRGCPSPYNDTMEKRIKRISIEGNIAAGKSTFVRLLEEQSKDWEVVPEPIARWC
NVQTENSDFEELTTSQKSGGNVLQMMYEKPERWAYTFQTYACMSRVRAQMKSTNGKLREA
DNPVQFFERSVYSDRYIFAANLYESECLNETEWSIYQDWHGWLHRQFGKHIQLDGIIYLR
VAPETCMERLRLRGREEEQGIPLEYLEKLHFKHESWLQHKTMRMEYQYLNDVPILTLDVN
EDFKVDKVKCADMIEKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttgctcgcgccgccgaagagaggatgtcctagtccttacaacgacacaatggagaag
agaataaaacgaatttcaatagaaggcaacattgccgcgggcaaatcaacatttgtgcgc
cttttggaagaacagagcaaagactgggaagtagtgcctgaacccatcgctaggtggtgc
aatgtacaaaccgaaaacagtgattttgaggagctgaccacatcccagaaaagcggtggt
aatgtcctgcagatgatgtacgagaagccagagaggtgggcctacaccttccagacctac
gcctgtatgagcagggtgcgtgctcagatgaaatccactaatggaaagctcagagaggca
gataacccagtgcagttctttgagcggtccgtctacagtgacaggtacatctttgccgca
aacctgtatgagagtgagtgtctgaacgagactgagtggtccatctaccaggactggcac
ggctggctccacaggcagtttggaaaacacatccaattggacggtatcatctacctccga
gttgcaccggagacatgcatggagaggcttcgtttgagaggcagagaagaagagcaaggc
attcctctggaatacctggagaaactccatttcaaacacgagagctggctgcagcacaaa
actatgcgtatggagtaccagtatctgaacgatgtgcccattttgacgctggacgttaac
gaagatttcaaagtggacaaggtcaagtgtgccgacatgatagagaaggtcaaagagttt
ctgagtaccttgtga

DBGET integrated database retrieval system