KEGG   Esox lucius (northern pike): 105027488
Entry
105027488         CDS       T04894                                 

Gene name
aff2
Definition
(RefSeq) AF4/FMR2 family member 2 isoform X1
  KO
K15194  AF4/FMR2 family member 2
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105027488 (aff2)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105027488 (aff2)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 105027488
NCBI-ProteinID: XP_010897913
UniProt: A0A3P8Y9E0
AA seq 1338 aa
MDLFEFDFFRDWELEQQCHYEQDRNALKKREWERRTQEVQQDEDLFSSGFNLFGEPYKTE
ARSLSTLGGTNNLNKTNKGDALANRVQNTLGNYDEMKELLTSHSNQSHLVGIPKNSVPQT
PGPVEKQDQPSLFTEGGQRGSSRTATGHHTTSMPPPPSSSSQTSSSLLHGHQSSKKSRSS
DWSRGAHGSSCSSQGAGGPACSRTKHTSSQEQLQPQRHKELFSSQGDVAGLKGESSGSSP
SSASTISRRPGGGQQQASKALSVAEHGVYKDGSAHVKSPLEQEPGPHGSGSPVASTSLLP
SGLSTPTFPQGLHVKPSAVQQQKPTAYVRPMDGQDQVPLDSPELKPPLEAGDVDYSNSAF
GPGITGSKSKLPKLTLTQAGEVSLSTESSCVEEILREMTHSWPPPLTAIHTPGKAEQTKF
PLPSKESQHLPSGYTGQKLCNVPGNKPATKSVPQKSMLEDDLKISSDEDDTEQQAAEKPK
PRSTPLSIPAAASRTSDPGHSSGASGSSSESESSSESDSDSESSSSGSECNRASRATTPE
PEPPSTNKWQLDKWLNKVTPHNKSLISTQPVRESHGLINSQPDNTQQPAENQGQPAGKSK
SGPNTMLSQTDPKERTLLSPIREKVKPKTGQKVSEGKSSKVKSPALLAVEPATARRSIGK
KQPKKVERSSSLEEHSSWTKPINPTISSTPKEKEPPPLLEPPKSRSKGTIGKTAPRKEPR
STTTTATNPAPPPPAPVLDKKKHRGPSKIIPKSKEFIETESSSSECHSEPEELVKIPNPP
CPGPSSQQTLKAAKDCNSNILSVSSLTSTCSTSISIPDPGVVGDLLEDPLFSPIPTVQNK
LLSPLREYEDIKSLWVKIELSFLSRIPGQDPADPPPLKVEPQEPNGKHKQQSPARLQSTP
VEKPPSKSKRKHKSDNWDAVGGSKKLRLEKEMLLPPCISPIHNHKNISTKDSLRKQPRKR
EEKRELLPPLLSPLSDEPPVCQRRTSECSSFSQEGGASTATGTLLLPSLSCSLPPFSTSS
SSSSSHKHRSKGESKSHYKTSSEEDTHSKPSNSFHGNGQSDSDVWSNPSSLSMDHMEPSR
PKLTFNNTVHNADYYMQEAKKLKHKADALMDKFGKAVNYADGALSFIECGNAMERDPLEA
KSPYTMYSETVELIRYAMRLKNFTSHSATVAEKKLAVLCNRCLSLLYLRMFKLKKDHAVK
YSRSLMEYFKNSAKSSQAPSPWGANGKSTGTPSPLSLSPSPVSSVSSSTGPAGSAPSGNV
AIPQRIHHMAASHVNITNNILRSYEHWDTAEKLAAESQEFFQELDSMMEPLSQHSTMAEL
VHYIRQGLHWLRIEAHLL
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggacctattcgagtttgacttctttagggactgggaactggagcaacagtgtcattat
gagcaggaccgcaatgcgctgaagaagagggaatgggagcggcggacccaggaggtgcaa
caggatgaagatctcttctcctctgggtttaatctgtttggggaaccatacaagacagaa
gcacgcagtctatccactttgggggggaccaacaacctaaacaagaccaacaaaggggat
gccctggccaacagggtgcagaacactctggggaactacgatgagatgaaggaactcctc
accagtcactccaaccagagccacttggtgggcatcccgaagaactctgttccccagacc
cctggccctgtggagaagcaagaccagccaagcttgttcaccgaggggggccagagaggg
agcagcaggacagccacggggcaccataccacttctatgccccctccgccctcctcttcc
tcccagactagctccagcctgctgcacggccatcagagctccaagaagtcacggtcttcc
gactggtcccggggtgcccacggatccagctgcagctcccagggggcggggggtccagcc
tgcagcaggacgaaacacacctccagccaggagcagctgcagccccagagacacaaggag
ctgttcagctcccagggcgacgttgcaggcctcaagggagagtcgtccggcagcagcccc
tcctccgcctccaccatctccaggaggcctggtggtgggcagcagcaagcatccaaggcc
ctgtctgtggccgagcacggtgtctacaaggacggcagcgctcatgtcaagtctcccctg
gagcaggagccgggcccccatgggtccggttcccctgtggcttccacctccctgttgccc
agtggcctctcaacgcccaccttcccccagggtctgcacgtcaagcccagcgctgtgcag
cagcagaagcccacggcatatgtccgacccatggacggtcaggaccaggtgccccttgac
tcaccagagctcaagcctcctctggaagcgggggatgtcgactacagcaactcggccttt
ggccccggcataacgggctccaaaagcaagcttcccaagctaaccctgacacaggccggc
gaggtcagcctgtccactgagtccagctgtgtggaggagattctacgggagatgacccac
tcctggcctcctcccctgactgccatccacactcctggcaaggctgagcagaccaaattc
cccttaccctccaaggagtcacaacacttaccctcaggatacactggacaaaagctgtgc
aatgttcccggtaacaagcctgcaaccaagtctgtgccacagaagtcaatgcttgaggat
gacctgaagatcagcagtgacgaggatgacactgagcaacaggcagcagagaaacccaag
ccccgaagtacacctctcagcatccctgcggctgcgtctcggaccagtgacccgggccat
tccagcggcgcttcgggcagctccagcgaatcggagagcagttctgagtcggactcagat
agtgagagcagctccagtggcagcgagtgtaacagggcctcacgagccaccaccccagag
cctgaacctccatcaacaaacaaatggcagctggataagtggctgaacaaagttaccccc
cacaacaaatctcttatcagcacccagccagtgagagagagccatggactcatcaactcc
cagcctgacaacactcaacagcccgctgagaaccagggtcagcccgcagggaagagcaag
tcaggcccaaacacaatgctgtcccagaccgatcccaaggaacggactctcctcagcccg
atccgagagaaggttaagcccaagactggacaaaaggtttcagagggcaagagttcaaaa
gtcaagtccccagcgctgttggcggtggagccagccacagccaggcgcagcattgggaag
aagcagccaaagaaagttgagcgctcgtctagcctggaggaacacagctcctggaccaag
cccattaaccccaccatcagctctactcctaaagagaaggagcctccgcctcttttggag
ccccccaagtccaggagcaagggtaccattgggaagactgcccctaggaaggaacctcgc
tccaccactaccaccgctactaatccagctcctcctcccccagccccagtactggacaag
aagaagcacagggggcccagcaagataatccccaaatccaaggagttcattgagacagag
tcttcgtcgtcggagtgccactctgaaccagaggagctggtcaagatccccaaccctccc
tgcccaggacccagcagccagcagactctcaaagcagccaaggactgcaacagcaatatc
ctgagtgtcagtagcctcaccagcacctgcagcacttccatctccatcccggaccctggt
gtggttggagacctactggaagaccccctcttctcccccatccccactgtccagaacaaa
ctgctgtcccctctcagggaatatgaggacatcaagtcattgtgggtgaagattgagctg
agcttcctatctaggatcccaggtcaggaccccgcagatccccctcctttgaaggttgag
ccccaggaacctaatggcaagcataaacagcagtcccctgcccgtcttcagtctacccct
gtcgagaaaccccctagcaagtccaaaaggaaacataagtcagacaactgggatgctgtc
ggcgggagcaaaaaactacggttggagaaagagatgcttcttcccccttgcatttcaccg
atacacaaccacaagaacattagcacaaaagactctctaaggaaacagcccaggaaaaga
gaggagaagcgagagctgctgcctccgctgctgtcgcccctctctgatgagccccctgtc
tgccagcgcaggacaagcgagtgttcctccttcagccaggagggcggcgctagcactgcc
actggcaccttattactaccctccctcagctgctctctgccccccttctccacgtcctca
tcctcatcttcttcacacaagcaccgcagcaaaggagagagcaaatcacattataagaca
agcagtgaggaagatacccacagcaagccctctaacagtttccatggcaacggtcagtct
gattctgacgtttggtccaacccatcatcgctgtccatggaccacatggagcccagcaga
cccaaactaacattcaataacacagttcataatgcagactactacatgcaagaagccaag
aaactgaagcacaaagcagatgcactgatggacaagtttggcaaagctgttaactacgcc
gacggcgcgctgtcattcatcgagtgcggcaatgccatggagcgggaccctctcgaggcc
aagtctccgtacaccatgtactccgagaccgttgaactcataaggtacgccatgaggtta
aagaacttcacgagtcactcagcaacggtagctgaaaagaaattagctgtattgtgcaat
cgctgtttatccctcctgtacttaagaatgttcaaactgaagaaggatcatgcagtaaag
tattcccgttccctaatggagtatttcaagaactcagcgaaaagttcccaagcaccttcg
ccatggggagccaatggaaagagcaccggcactccatcaccgctgtctctgagtccctcg
ccagtgagttcggtcagcagcagtaccggccccgcgggctccgcgccgtccggcaacgtg
gccatcccccagcgcatccaccatatggccgccagccacgtcaacatcaccaacaacatc
ctccgcagctacgagcactgggacacggccgagaagttggccgcggagagccaagagttc
tttcaggagctggactcaatgatggaaccgttgagccaacacagcaccatggctgaactg
gtgcactacattcgccaagggctgcactggctacggatagaggcccacttgttatag

DBGET integrated database retrieval system