KEGG   Esox lucius (northern pike): 105027931Help
Entry
105027931         CDS       T04894                                 

Definition
(RefSeq) BDNF/NT-3 growth factors receptor
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105027931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105027931
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105027931
Protein kinases [BR:els01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   105027931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 LRR_8 C2-set_2 LRR_5 ig LRRNT Haspin_kinase TILa LRR_4
Motif
Other DBs
NCBI-GeneID: 105027931
NCBI-ProteinID: XP_010898625
AA seq 801 aa AA seqDB search
MDSNVGEYGMARLGIFMVLVGLWRFSAACPASCTCSISRIACIDPGPGIEDFPILTLDDM
EMDINITDIYIANQNRLFDINDNSLKYYSNLRNLTVINTRLTSISSQAFNNNTRLQYLNL
RDNNLSTLSWRTFQNLNMTSFPLLSGNPLKCVCENLWIKLRLQEDVESPEKEDLKCIDER
GRRKSISRISPPDCEAPAAEVSPSIVTKKEGSDVAAVCSATGSPAPEIMWNTENLFTIAD
TNPLDMESILTLSGLSPSDNGRVITCSVENIVGQSEAYLQLNILFRPTILELLEPLNLHH
WCIPFTVTGNPKPELQWYHQDQKLHEQEYIKTEIHESLGSVHHGCLQLVNPTHIHNGQYT
LVARNEYGEDSKVIDAHFLLPPNDYPDTESPYYPFTTDPPLPPIDDSVAVYVVVGIAGVA
LIGCVLMVIILKYGRNSKFGMKGSSSVISNDDDSASPLHHVSNGNNTPSSSEMGHDAVII
GMTKIPVIENLQYFRQSGSMLKSDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLTPD
QDKILVAVKTLKEASESGRADFHREAELLTNLQHEHIVTFYGVCVESDPLIMVFEYMKHG
DLNKFLRSHGPDAVLMADGQHSLMVELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRN
CLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRRFTTESDVWSLGV
VLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRSCPKEVYDLMLGCWQREPYMRHHIK
EIYSLLQSLAKASPVYLDILG
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggactccaacgtaggggaatatggaatggctcgcttgggaatctttatggttttggtg
gggttatggaggtttagcgctgcttgccctgcatcctgcacttgcagcatctcaaggatt
gcttgtatcgatcctggaccggggatcgaggatttccctatccttacgttagatgacatg
gaaatggacatcaacatcactgatatatacattgcaaatcaaaacagactatttgacatc
aatgataacagcttgaagtactactcaaatctcagaaatctaactgtgataaatacgaga
ctgacttctatctcatcacaggcctttaacaacaatacaagacttcaatatctgaatctg
agagacaacaacttgtcaacactgtcttggaggacattccaaaacttaaacatgacatct
tttcctctgctgtctggtaaccctctgaagtgtgtgtgtgagaacctctggatcaagttg
aggctccaagaggatgtggagagtccagagaaagaagacctaaagtgcatagatgaaaga
ggaaggaggaagtccatctccagaatatctccccctgactgtgaggctccggcagcagag
gtcagtccttcaatcgtcacaaagaaggaaggaagtgatgtcgcagcagtgtgcagtgca
acagggtctcctgccccagagattatgtggaatactgagaacctcttcactattgctgat
accaaccccttggatatggagagcattctgacactctcaggtctctcaccttcggacaac
ggcagagtgataacctgcagtgttgagaacatagtcggccagtccgaggcttacctgcaa
ctcaacatcctctttcgccccactatcctggagctgttggagccactgaatctccaccac
tggtgcattcccttcactgttaccgggaaccccaagccagagctccagtggtaccaccag
gatcagaagcttcatgagcaggaatatattaagacagagatccatgaaagccttgggagt
gttcatcacggctgcctgcagctcgtcaaccccacccacatccataatgggcagtataca
ctggtggctaggaatgagtacggggaggacagcaaagtaatcgatgcccacttcctgctc
ccgccaaacgactacccagatacagaatcgccatattacccgtttaccaccgacccccca
ctacctccaatagacgacagtgttgcagtgtacgttgtagtgggaatcgctggtgtggcg
ttaattggatgtgttctaatggtgatcattctaaaatatggaagaaactcaaagtttgga
atgaagggctcctcctcagttatcagtaatgacgatgattccgccagtcctcttcatcac
gtatccaacggcaacaacactccatcgtcctcagagatgggccacgatgcagtgatcatt
ggaatgacaaagatcccagtcatcgagaacctgcagtatttccgtcagtctggcagcatg
ttgaaatcagacacgtttgtccagcacataaaaagacacaacattgtgcttaaacgtgag
ctaggagagggggccttcggcaaggtgttcctggctgagtgctataacctgaccccagat
caggacaagatcctggttgctgtcaagacattgaaagaggcaagcgaaagtggacgcgct
gacttccaccgagaggcagagctactgacaaacctgcagcacgagcatattgtcaccttc
tatggcgtgtgtgtagagagcgatcccctcatcatggtctttgagtacatgaagcacgga
gacctcaacaagttcctcaggtcccatggtcccgacgcggtgctgatggctgatggccag
cacagcctgatggtggagctgacccagtcccagatgctgcacatcgcccagcagatcgcc
gcaggcatggtctaccttgcctcccagcacttcgtacacagagatctggccacacgtaac
tgcctggtgggcgagaacttgctggtcaagattggagacttcggcatgtccagggatgtt
tacagcaccgactactacagagtgggaggtcacactatgctgcccatccgatggatgccg
ccggaaagcatcatgtaccggaggttcaccacggagagcgacgtctggagtctgggtgtg
gtactctgggagatcttcacatatgggaagcagccctggtaccagctctccaacaacgag
gtgatcgagtgcatcacccaaggacgcgtgctgcagcggccacgttcctgtccaaaggag
gtgtacgacctaatgttggggtgctggcagagagaaccctacatgagacatcacattaag
gagatctacagcttgctccagagtctggccaaggcctctccagtttacctagacatcctg
ggctga

DBGET integrated database retrieval system