KEGG   Esox lucius (northern pike): 105028308Help
Entry
105028308         CDS       T04894                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
els  Esox lucius (northern pike)
Pathway
els00450  Selenocompound metabolism
els00970  Aminoacyl-tRNA biosynthesis
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105028308 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105028308 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:els01007]
    105028308 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:els03016]
    105028308 (mars)
Enzymes [BR:els01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105028308 (mars)
Amino acid related enzymes [BR:els01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105028308 (mars)
Transfer RNA biogenesis [BR:els03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105028308 (mars)
 Prokaryotic type
   Other AARSs
    105028308 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 GST_N_4 tRNA-synt_1e GST_N_3 Tom37 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 105028308
NCBI-ProteinID: XP_019900676
UniProt: A0A3P8Y154
AA seq 1011 aa AA seqDB search
MKLFVSEGNPHCLKVLAVLKLTGVKCDVQHVNHEEKVVPHLSRPTLPALLLPSGMHLFSA
NSICRYLGEVSGQPSSDLNNQWLEWEASELQPAVAQALHLAVLQGKGSEASSALQGQLSY
LEQSLCKKTTPFLTAEIVSVADVVLWAALYPILSDHGLVLGDQGKVQNWFERVGMLAACE
SAAQEVLQGKGLKSEALKAYMQKQPAPPHSQAQKRDNQPCNSPEQVADGDRVMSEEEILS
ATVTWAKGLADRPMISDRQHPILPKEGKRNILVTSALPYVNNVPHLGNIIGCVLSADVYA
RYGRLRGWNVLYVCGTDEYGTATENKAREEGLTPQQICDKYHTVHASIYQWFQVDFDYFG
RTTTEKQTQIAQNIFWRLHERGFLLEDTVEQLRCEMCQRFLADRFVEGTCPYCAYPEARG
DQCDKCGKLINAVELQEPKCKVCNQTPVVRSSKHLFLDLPKLEAPLEQWLEKSMGSGDWT
ANAKQITRSWLRDGLKPRCITRDLKWGTPVPHPDFSDKVFYVWFDAPIGYLSITANYTDQ
WEKWWKNPEQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYSLVNHLVATEYLNYEDTKFS
KSRGVGVFGDMAKDTGIPSDVWRFYLLYLRPEGQDSAFSWADMAIKNNSELLNNLGNFIN
RAGMFVSKFFENCVPAMDLQPEDKRLLALVGWELKQYISLMDKVKIRDSLKCILNISRLG
NQYIQVNEPWKKIKGGDTDRQRAGTVTGVSVNIACLLSVMLLPYMPTVCQTIREQLNAPP
TVTATMLQGTGNFVCCLPAGHHIGVVSPLFQKLEADQIEDLKKRFGGQQTEEEETIWNKP
KASTQADVVTQPATTSAGQTVKNGADPERAKELTLAVAGQGEKVRALKGQKAEKAVIAVE
VDKLLDLKKQLALAEGKNQEPDQTKGTKNTQHAPCPATTAQAVINKADPERAKELTLAVA
EQGEKVRMLKGQKAEKAAITTEVDKLLDLKKQLALAEGKNPEPTLTKGKKK
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcgtgagtgaaggaaatccgcactgtttaaaggtgttagcagtgcttaaa
cttactggagtcaaatgtgacgttcagcatgtcaaccacgaagagaaagtggttccccac
ctcagccgtccaaccctgcccgccttactccttcccagcggcatgcatctcttcagcgcc
aacagtatctgcaggtatctgggtgaggtgagcggacagccatccagtgatcttaataac
cagtggcttgaatgggaggcctctgaacttcagcccgcagtggctcaggccctccacctg
gcagtgctgcaggggaaaggatcggaagcctctagtgctctacagggacaactcagttac
ctggaacagagtctgtgcaagaaaactacgccattccttactgctgaaatcgtttctgtg
gcagacgttgttctctgggcagctctctaccccatcttgtcagaccacggtttggtgtta
ggtgaccagggaaaggtgcagaactggtttgagcgtgttggcatgctggcggcctgtgag
tctgcagcccaggaggtactgcaagggaagggactgaagtctgaggctctgaaggcctac
atgcagaaacagcctgccccgccccatagccaggctcagaagagagacaaccagccctgc
aacagccctgagcaggttgctgatggggatcgtgtgatgtcagaagaagagatcctgtct
gcaacagtcacctgggctaaaggattggcagacagacccatgatttcagatagacaacat
cccattctccctaaagagggcaagaggaacatcctagtgaccagcgccttgccatatgta
aataacgtcccccacctgggcaacatcatcggctgtgttctcagcgctgacgtctacgcc
aggtatggtcgtctgcgtggctggaacgtgctgtatgtgtgtgggacagacgagtatggc
acggctacagagaacaaggcccgtgaggagggcctgacgccacagcagatatgtgataag
tatcacaccgtccatgcctccatctaccagtggttccaggtcgacttcgactactttggc
cgcaccaccacggagaaacaaacccagatagcccagaacatcttctggcgtctccacgag
cgaggcttcctgttggaagacacggtggaacagctgcgctgcgagatgtgccaacgtttc
ctagccgaccgtttcgtcgagggcacctgtccctactgtgcctaccccgaggcccgagga
gaccagtgtgacaagtgtggcaagctcatcaacgctgtagagctacaggagcctaaatgt
aaggtttgcaatcagactcctgtggttcgctcctcaaaacacctcttcttggacttgcca
aagctggaggcgccgttggagcagtggctggagaagtcaatggggtctggagactggacg
gccaacgccaaacagatcacccgttcctggctgagggacggactcaaaccccgctgcatc
acccgagatctcaagtggggaacccctgtgcctcacccagacttctctgacaaggtgttc
tatgtgtggtttgatgctcctattgggtacctgtccatcactgccaactacactgaccaa
tgggagaagtggtggaagaacccagagcaggtggagctgtataacttcatggccaaagac
aatgttcccttccatagtgttgtcttcccctgttctctgctgggagcccaagacaactac
tcactggtcaaccacctggtggctacagagtacctgaactacgaggacaccaagttctca
aagagtcgtggggtaggtgtgttcggagacatggccaaggacacaggcatcccttctgat
gtgtggcgattctacctgctctacctgcgtccagaggggcaggattcagccttctcttgg
gctgacatggccatcaagaacaactctgagctgctgaataaccttggcaactttatcaac
cgagctggtatgtttgtcagtaagttctttgagaactgtgtgcctgctatggaccttcag
ccagaggacaagaggctgttggccctggtgggatgggagctgaagcagtacatcagcctc
atggacaaagtcaagatccgggacagcctaaagtgtatcctcaacatctctcgccttggc
aaccaatacatccaggtcaacgaaccctggaagaagataaaagggggagacacagacagg
caaagagcgggcacagtgacgggagtgtcggtgaacatagcatgcctcctttctgtcatg
ctcctgccatacatgccaaccgtctgccagacaatccgcgaacagctcaacgccccgccc
accgtcactgccaccatgctgcagggcactgggaacttcgtctgctgtctgccagctgga
catcacattggcgtggtcagccctttgttccagaaactagaggcagatcagattgaggat
ctgaagaagaggttcggaggccaacagactgaggaagaagaaaccatatggaataagcca
aaagcatccacccaggcggatgtcgtcacacagcccgccacgacctcagctggtcagact
gtgaaaaacggagcagaccctgagagggccaaggagctaacactcgccgtggcaggccag
ggcgagaaggtccgagcgctgaaggggcagaaggcagagaaggctgtgatagctgtggag
gtggacaaactactggacctgaagaagcagttagccctggctgaggggaagaaccaagaa
cctgaccaaacaaagggcacaaagaacacacagcacgccccatgcccagccactactgct
caggctgtgataaacaaagcagatcctgagagagccaaagagctaacgctggctgtggct
gaacagggcgagaaggtgcggatgctgaagggtcagaaggcggagaaggctgctataacc
acggaggtggacaaactactggacctgaagaaacagctagccctggctgagggcaagaac
cctgaaccaacccttaccaaaggcaaaaagaagtga

DBGET integrated database retrieval system