KEGG   Esox lucius (northern pike): 105028905Help
Entry
105028905         CDS       T04894                                 

Gene name
gucy1a1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els01100  Metabolic pathways
els04270  Vascular smooth muscle contraction
els04540  Gap junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105028905 (gucy1a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105028905 (gucy1a1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105028905 (gucy1a1)
Enzymes [BR:els01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105028905 (gucy1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB TMEM126
Motif
Other DBs
NCBI-GeneID: 105028905
NCBI-ProteinID: XP_010900264
UniProt: A0A3P8ZHE3
AA seq 726 aa AA seqDB search
MFCAKLKDLKISGECPFSGVASGEEPEDFEECIRDHTADVLPISKDVYGKTSEVLPQRKT
SRTRVNLHSLGESIRKLACPEFQRLHTAFLQMMKQHTLNKKCPTVCYSDICQDRSFDRTE
HLLEIMKTYSLKTGINMDALKVSLGEELFKTCFEEDGHILQVVGGALSDFLNSFNVLLKQ
NSAPATPGPAFSAAPDKRTDYVNNEAASVLCLDKDPGLLTVYYFNPGPTTELYFPGVIKA
AARLLYHTTVEVLTDMEMEMDLQGGTKENAAPLQAQAGLQVGPRQPSLLYSVVAKDTKSL
SPSPMRATSAGTIPTSLFSTTFPFHIFLDQDLGLLQIGDGLRKRLCRKDGLRRPASFQEH
FAIVTPQIRCTFQGILTMLNTQFIVRIKHQGGSVTDDTGKLMDLKGQMIYISESNAILFL
GSPCVDKLEELTGRGLYLSDIPIHNALRDVVLVGEQAKAQDGLKKRLGKAKAALEHAHLA
LEEEKKKTVDLLFTIFPGTVAQELWQGHTVDAREFEHVTMLFSDIVGFTAVCSSCTPMQV
VTMLNELYTRFDHHCGELDVYKVETIGDAYCVAGGLHKESETHAVQIALMALKMMELSDE
VRTPTGEPIKMRIGLHTGSVLAGVVGVMMPRYCLFGNNVTLANKFESCSVPRRINVSPTT
HRLLKDCPEFVFIPRTRQDLPPNFPPDIPGVCYFLEAFDQWSGKTTRDCETEELCYSNTN
FMAEQT
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtgcaaaattgaaagacctgaaaatctctggagaatgcccattctccggtgtc
gctagtggggaagaacccgaagactttgaggaatgtataagggaccataccgccgatgta
ctgccaatttccaaggatgtgtatggaaaaacatccgaagtgctacctcaaaggaagaca
agcagaactagagtcaatcttcattcattaggggagagcatccgcaaattggcatgtcct
gagtttcaaagactgcatactgcatttctacaaatgatgaaacagcatacattaaacaaa
aaatgcccaacagtgtgttactcagacatctgccaggataggagctttgatcgaacagag
catttactggagatcatgaagacttattctctcaaaacaggtataaacatggatgctttg
aaagtctctcttggagaagagcttttcaaaacgtgctttgaggaggacggacacattctg
caggttgtagggggagcactcagcgactttctgaacagcttcaatgtcctgttgaaacag
aacagtgccccagctacgccaggaccagccttttcagctgccccagacaagagaacagat
tatgtaaacaatgaagcagcgtcagtgctgtgcctggacaaggatccgggtctgctcact
gtctattacttcaaccctgggccgaccaccgagctctactttccgggggtcatcaaggcg
gctgcacgtctcctttaccacaccaccgtggaggtgttgacagacatggagatggagatg
gaccttcaaggaggcaccaaggaaaacgcagccccattgcaggcccaggctggattgcag
gttggaccccggcagcccagcctgctctactcggtggtagcaaaggacaccaagagcctg
agccccagtcctatgagggccacgtcggctggcaccatccccacctcactcttctccacc
accttcccctttcatatcttcctggatcaggatctgggcctgctgcagatcggggacggc
ctcaggaagaggctttgtcggaaggatggcctgaggcggcctgcttcgttccaggagcac
tttgccattgtcacaccacagatcaggtgcacctttcaaggcatcttgactatgctgaac
acacagttcatagttcgaataaaacaccaagggggctctgtgacagatgacaccgggaag
cttatggacttgaaaggccagatgatttacatctctgaatccaatgcaatcctctttctg
ggctcgccatgcgtagacaagctggaggagctgaccggtcgcgggctatacttatccgac
attcccatccacaatgccctccgcgatgtcgtcctggtaggtgagcaggcaaaagcccag
gatggcctgaagaagcgcctgggaaaagccaaggcggccttggagcatgcccacctagcc
ctggaggaagagaagaagaagacagtggatctgcttttcacaatttttccaggcactgtg
gctcaggaactttggcaaggccacacggtggatgctagggagtttgagcacgttaccatg
ttgttctcagacatcgtgggtttcacggccgtgtgctcaagctgcacgcccatgcaggtt
gtcaccatgctcaacgagctgtacacccgatttgatcaccactgtggggagctggatgta
tacaaggtggagactataggtgatgcgtactgtgtggccggtggcttgcacaaggagagc
gagactcacgctgtgcagattgcactcatggcactgaagatgatggagctatccgatgag
gtcaggacgccaactggcgagccgatcaagatgcggattggtctgcacactggttcagtt
ctggctggtgtagttggagtgatgatgccacgctactgtttgtttggcaacaacgtcacc
ttggccaataagtttgagtcctgtagcgtacctagaaggatcaacgtcagccctacaaca
cacaggttactgaaagattgtcctgagtttgtcttcattccacgaaccagacaggatctt
ccgccaaacttcccgccggatattcctggtgtttgttacttcttggaggcttttgatcaa
tggtccggcaaaaccacaagagactgtgagacagaggagctgtgctacagcaatacaaac
ttcatggctgagcaaacatag

DBGET integrated database retrieval system