KEGG   Esox lucius (northern pike): 105029114
Entry
105029114         CDS       T04894                                 

Gene name
gtf2ird1
Definition
(RefSeq) general transcription factor II-I repeat domain-containing protein 1
  KO
K03121  transcription initiation factor TFII-I
Organism
els  Esox lucius (northern pike)
Pathway
els03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    105029114 (gtf2ird1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105029114 (gtf2ird1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105029114 (gtf2ird1)
SSDB
Motif
Pfam: GTF2I
Other DBs
NCBI-GeneID: 105029114
NCBI-ProteinID: XP_010900592
UniProt: A0A3P8YVK9
AA seq 998 aa
MAQMRKSGCDGIRTNSRVELRVPQVSARQEILTSLVSALDSVCTAMSKLNAEVACVTVHE
DSVIAVGTEKGRVFLNSRREIQTDFHKFCRLPCLQGFTTMNAHAKVQESDSSKLCKEAGQ
GKQRASTDNHSNIFVLRKMVEEVFSVLYSEAVGKSSLVPVPYDWILKDPSSVVAHGLPDG
ITLRKPAEYDTSTLMKILEQSNRIHFTVKRATEEPLRDVKSCGSDVSNHNSSLGTTKSLA
NHSPASKLAAAAQEVSATSVSASNSMLSSFLYGMPMSSQPHPDSQLDLKPTSLLNLGKDR
LGVWAIGAEKGTAAKDGSDNGERIGLQGELGQSPPSIHVSKRLLFSIVHEKSEKWDSFIR
ETEDINTLRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIIGIPDKIPFKRPCT
YGVPKLKRILEERHGVRFVVKRMFDERIFTAAGKVAKEEGKQDISTTSEDSFPDNLRVPS
TVLELANNPHSSRSTSSCVSPLVDCEAGPSGDCIPLKKIKTEPPDGEIIQVTVPEASVSV
EEPSEPPVDSAATAVVTANPPQAAPRHLLETHPAEALSPKPASQSLRRSPEGNLAEDIGE
MILQLRRQVESLFSTKYAEALGLPEPAKVPYSKFQMYPEDLCVTGLPEGMAFRRPNCFGA
TKLRRILTVGSQIQFVIKRPELLTDQVKLEPPPLPACDSDLDSKDALTEDIGADSKRPGF
SDSLEAKLSRIDLANTLREQVQDLFNRKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPP
GIPFRKPCTFGSQNLERILAVADKICFTITRPFQGLIPKPAPRRITLLKKAYASISDDEE
VNRMGEKVILREQVKELFNQKYGDALGLNRSVLVPYKLIRASPDSVEVSGLPDDIPFRNP
NTYDIVRLEKILQAREEITINVKSQLQPFAEICTQACNTEGKEVSTNRRKRKRVLESSRV
SIPSDSGVSTNQIPVMQWPMYMVDYSGMNVQVPGKVKY
NT seq 2997 nt   +upstreamnt  +downstreamnt
atggctcagatgaggaagtcaggatgtgatgggataaggactaactcccgggtcgaactc
cgggtcccacaggtttcggccaggcaggagatcctaacgagcctagtttctgctctagac
tcagtgtgcacagccatgtcaaagctaaacgcagaggtggcatgcgtcactgtgcatgag
gacagtgtgatcgctgtgggaacagagaagggaagagtcttcctcaactcacggagggaa
atacaaacagacttccataagttttgcaggttgccctgtctgcaagggtttaccacaatg
aatgcccatgccaaagtacaggagagtgactccagcaagctctgcaaagaggctgggcag
ggcaaacagagggcttcaacagataaccactctaacatctttgtcttaaggaagatggtg
gaagaagtcttcagtgtactttacagtgaggctgttgggaagagcagcttggtccctgtg
ccttatgactggatcctgaaggaccccagctctgtggtggcccacggcctgcctgatggg
atcaccctgaggaaacctgccgagtatgacactagtactttaatgaagatcctggagcag
agcaatcgcatccatttcactgtcaaaagagcaacggaggagcccttgcgtgacgtcaag
tcctgcggcagtgacgtcagcaatcataactcctctttgggcaccaccaagagcctagcc
aaccacagcccggcctccaagcttgccgccgctgcacaggaagtgtctgccacttcagtc
tccgccagcaactccatgctgtccagcttcctgtatggcatgcccatgtcctcccaacca
caccctgatagccagctggacctgaagcccacgtcccttctcaacctgggtaaagaccgc
cttggggtttgggcaataggtgcggaaaaaggcacggctgctaaggacggttctgacaac
ggtgagcgtataggactgcagggggagttgggccagagccctcccagcatccatgtttcc
aagcgcctgctgttttccattgtacatgagaagtcagaaaagtgggactcgttcattcga
gagacggaggacatcaacacgcttagagaatgtgtgcagatactcttcaacagtcgctat
gcggaggccttaggcttggaccatatggttccagtgccttaccgcaagattgcttgtgac
ccagaggccgtggaaatcatcggcatcccagacaagatccccttcaagaggccttgcacc
tatggagtgcctaaactcaaacgtatcctagaggagcgccatggggtccgctttgtagtc
aaaagaatgtttgatgaacggattttcacagctgctggtaaggtggccaaggaggaaggc
aagcaagacataagcactacttccgaggatagtttccctgacaacctccgagtcccatcg
actgtgctggagctggccaacaatcctcacagtagcagatcgacaagctcttgtgtgagt
ccattggttgactgcgaagcaggaccttcaggagattgcattcccttgaaaaagatcaaa
actgagcccccagatggggagatcatccaggtgactgtaccagaagcaagtgtttcagtg
gaggagcccagtgagcctccagtcgactcggctgcaacagcagtggtgacggccaatccg
ccacaggctgctccccgccacctcctggagacccacccagctgaagcactgtcacctaaa
ccagcttcacaaagcctcagaagatctcctgaaggaaatcttgctgaggacataggtgaa
atgatcctccagcttaggaggcaagtggaaagtctattcagcactaagtacgctgaggcg
cttggactacctgagcctgcgaaggtgccctactccaagtttcagatgtacccagaggat
ctgtgtgttacagggttacctgagggcatggctttccgcaggcccaactgttttggtgcg
accaagctacgaaggatcctaacggtcggcagccagattcagtttgtcatcaaaaggcca
gaactgttaacagatcaagtcaagctggagccaccacctctcccggcctgtgattcagat
cttgactctaaagatgctttgacagaagatattggggctgattcaaaaagaccaggcttc
tcagatagcttagaggccaagctgtccaggattgacctggccaacaccctgagagagcag
gtccaggatttgttcaacaggaagtatggggaggcacttggtatcaaataccctgtccag
gttccttacaagaggatcaagagcaacccaggctcagtgattatcgagggcttgccccct
ggcatccccttcaggaaaccttgtacctttggctcacagaacttggagaggatcttggca
gtagctgataagatctgcttcaccatcaccagacctttccaaggactcatccctaaacca
gcacctcgccggataactttattgaagaaggcctatgcttcaataagtgatgatgaagag
gtcaatcgcatgggggagaaggtgatcctccgtgagcaagtgaaagaacttttcaaccag
aaatatggtgatgctttgggcctgaaccgctccgtcctagtcccatacaagctgattcga
gccagtcccgactctgtggaagttagtggccttccagatgatattcccttcagaaatcca
aacacttatgacatagtccgcctggaaaagatccttcaagccagagaggaaatcacaatc
aatgtcaagagccagctacagccttttgcagaaatatgcacccaagcttgtaacacagaa
gggaaagaggtttctaccaatcgacgcaagcgcaaaagagtcctggaaagcagccgagtg
tccataccttccgattcaggggtttcaaccaatcagattccagtgatgcaatggcctatg
tacatggtggactacagtggcatgaatgtgcaagtccctgggaaggtgaaatactag

DBGET integrated database retrieval system