KEGG   Esox lucius (northern pike): 105029160
Entry
105029160         CDS       T04894                                 

Gene name
ctdspl
Definition
(RefSeq) CTD small phosphatase-like protein isoform X1
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105029160 (ctdspl)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105029160 (ctdspl)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105029160 (ctdspl)
Protein phosphatases and associated proteins [BR:els01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   105029160 (ctdspl)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105029160 (ctdspl)
SSDB
Motif
Pfam: NIF
Other DBs
NCBI-GeneID: 105029160
NCBI-ProteinID: XP_028972248
AA seq 289 aa
MDNTSIITQVANPKEEESISSSQEKGLPLGFWGLQHGLKKHSSVLQQQSDTSLKKSRSRS
IFSPFFCCFTNYHVDPPSSQSTNNKTQALPPPTTDENGSPPKPPAKSLLPEVNISDCGKN
CVVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDVFLQKMGELFECVLF
TASLAKYADPVADLLDQWGVFRARLFRESCVFHQGNYVKDLSRLGRRLSNVIIVDNSPAS
YIFHPENAVPVQSWFDDMSDTELLDLLPVFEGLSKEQDVYNLLQSLRVR
NT seq 870 nt   +upstreamnt  +downstreamnt
atggacaacacgtccatcataacacaggttgcaaatccaaaagaggaggaaagtatttct
tcaagtcaagagaaaggtcttccactgggtttttggggactccagcatgggctaaagaaa
cacagctcagtgttgcagcagcagtccgacactagcctgaagaagtcccggagtcgaagc
atcttcagccctttcttctgctgctttacaaactaccatgttgaccctccatcatcgcag
agcaccaataacaagacccaggccctgccccctcccaccactgatgaaaatggcagcccc
ccaaagcctccagccaagtccctgctaccagaggtcaacatctcagactgtgggaagaac
tgtgtggtgatcgacctggatgagactctggtacacagctccttcaagcccatcagcaac
gcagacttcatcgttcctgtggagatagatggtactgttcatcaggtgtacgtgttgaag
aggccgcatgttgacgtgttcctgcagaagatgggggagctgtttgagtgtgtcctgttc
acagcaagcttagccaagtatgcagacccagtggctgacctgctggaccagtggggtgtg
ttcagggcccgtttgttccgggagtcctgtgtgttccaccaggggaactacgttaaagac
ctgagccggctggggagaagactcagtaacgtcatcatcgtagacaactctccagcctca
tacatcttccaccctgaaaatgctgttccggtccagtcctggtttgatgacatgtcagac
actgagcttctggacctgctgcctgtgtttgaggggttgagtaaggagcaggacgtttac
aacttgttacagagcctccgggtcaggtag

DBGET integrated database retrieval system