KEGG   Esox lucius (northern pike): 105029773
Entry
105029773         CDS       T04894                                 

Gene name
rnpepl1
Definition
(RefSeq) aminopeptidase RNPEPL1 isoform X1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105029773 (rnpepl1)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105029773 (rnpepl1)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105029773 (rnpepl1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 105029773
NCBI-ProteinID: XP_010901592
UniProt: A0A3P8ZLG7
AA seq 700 aa
MAEFQRPTLCCCRKALTVPSKSCEGGRNLAQCRLVDIASASNFHSFKLRHFHLDLRLNFA
VKEMTGWQVLELVPIQPGAHTLVLDSHPSLLIHSIDCKVPGTTAAQDITLSLTYRVDPFT
DYGSSLNISLPASVTRPHRAFQITVRYTTTDGPAIWWLDAELTCGQTRPLVFTQGHSVCN
RSFFPCFDTPAVKSTYSATVRVPEGVTVLMSASRSAYSKQERVFQFSMEYPVPAYLVALV
AGDLQHADIGPRSRVWAEPCILACAVSKLGGSVERWLNVAEDLFGPYVWGRYDIVFLPPS
FPIVAMENPCLTFIISSILESREFLLIDVIHEIAHGWFGNAVTNATWEEMWLSEGLATYA
QRRITTEAYGEAFTCLETVFRLDALHRQMRLLGDNNPVSKLQVKFEPGINPSSLMNLFTY
EKGFCFVSYLSQLCGDVKSFDSFLRAYIEQFKFTSVVAQDLLDFFLGFFPELKESCVAQR
EGLEFERWLNDCGPPLCEPDLSAGGVLTGPVQSLCDLWACDPQDPEAIANFNLSSWSTFQ
TVLFLDRLLDRSPLSNQVMGQLSRCYSAQLDEMNAEVQIRWLQIVVRNSFYPDLPRVRGF
LHKHTSRMYTVPLYEDLCAGVMKCFAAEMFYQTQTRLHPNLRRTLQQILFQTSALPPTTG
SVSSLLPTAIPSSPTPGGHPGPTDPPGTGTIALRDVNVSA
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggccgaattccagcgaccgacactgtgttgctgccgcaaagcgctgacagtgcctagc
aagtcgtgtgagggcggccgaaatctagctcagtgtcgccttgtggacatcgcctcagcg
tccaactttcacagcttcaagctccgacactttcatttagacctgcgcctcaactttgca
gtaaaagagatgaccggctggcaagtcctggagcttgtgcctatccaaccaggagcgcat
actttggttttggactctcatccgtcgttgcttattcattccatagactgtaaggtacct
ggcaccaccgctgcccaggatattactctatcgctcacctaccgggtagatccatttaca
gactatggatcctcgctgaacatcagcctcccagcctctgtgacgcggccgcatcgagct
ttccagatcaccgttcgttacaccacgacagatggtcctgcgatctggtggctggatgca
gagctgacgtgtggacagacacgcccactggtctttactcagggccactctgtctgcaac
cgctccttcttcccttgctttgacacgcctgccgtcaagagcacttacagtgctactgtc
agggttccagagggtgtgactgtgctgatgagtgcctcccgaagcgcctactccaagcag
gaaagggtgttccagttctccatggagtaccccgttccagcgtacctggtggccctagta
gcgggggacctgcagcacgctgatattggccccaggagccgggtatgggcggaaccatgt
atactggcctgtgctgtaagcaagctaggaggcagcgtggagcgttggctgaacgtggcc
gaggacctcttcggaccctacgtgtggggaaggtacgacatagtcttcctgcctccgtcg
ttcccaattgtggccatggagaacccctgtctcaccttcatcatctcctccatcctggaa
agccgggagttcctgctcatcgacgtgatccatgagatcgcccacggctggttcggcaac
gctgtcaccaatgccacatgggaggagatgtggctgagcgagggcctggccacgtatgct
cagagacggatcactacagaggcctacggtgaggccttcacctgtctggagacagttttt
cgcctagacgccctgcacagacagatgcgcctcctaggagacaacaaccctgtcagcaag
ctgcaggtcaaatttgagccaggtattaatcccagtagtctgatgaatttgttcacctat
gaaaaaggcttctgcttcgtctcgtacctctctcaactctgtggtgacgtcaaaagtttc
gacagtttccttagggcgtacatagagcagtttaagttcaccagtgtagtggcccaggac
ctgctggatttcttcctgggcttcttccctgagctgaaggagagctgtgtggcccaaaga
gaggggctggagtttgagcggtggctgaatgactgtggcccccccctgtgcgaaccggac
ctttcggctggtggtgttctcaccggtcctgtccagagtctgtgtgacctgtgggcttgt
gacccccaggacccagaggccattgccaacttcaacctctcctcctggagcacctttcag
accgtcctgttcctggaccgactgctagaccgctcacccctctcaaaccaggtgatggga
cagttgtcgcggtgctactcggcccagctggatgagatgaatgccgaggtgcagatccgc
tggcttcagatcgtggtgcggaacagtttctacccagacctgccccgtgtccgcggcttc
ctgcacaaacacacgtcgaggatgtacacagtgcccctgtacgaggacctgtgtgccggt
gtgatgaagtgctttgcggccgagatgttctaccagacacaaacccgcctccaccccaac
ctccgacggacactccaacagatcctgttccagaccagcgccttacccccaaccacaggc
tcagtctcctccctgctacctaccgctatcccctcatcccccacccctggcggtcacccg
gggcccactgacccccccggtactggtactatcgcactacgagacgtcaacgtgtctgcc
tga

DBGET integrated database retrieval system