KEGG   Esox lucius (northern pike): 105029824
Entry
105029824         CDS       T04894                                 

Gene name
iws1
Definition
(RefSeq) protein IWS1 homolog isoform X3
  KO
K17498  transcription factor SPN1
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105029824 (iws1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105029824 (iws1)
SSDB
Motif
Pfam: Med26
Other DBs
NCBI-GeneID: 105029824
NCBI-ProteinID: XP_010901666
UniProt: A0A3P8ZPR2
AA seq 786 aa
MDGDEDEFFSGNHSGSDDGGGTPVQDEHAPDSDAEEMSEPRHSEDEGSDGEGATSAMETN
GIASGSDNEGPKVANSDSEEEAPNHSDSEPEAPRPADSDAEESPVKGRISTSDVEGSPGP
ERRGSISDIEGSSVKRRGSTSDTEGSPVNRRSSPSDVDGHATSNRGGSHSDVEGSPLTKH
KDSNSDVEGYPVKCRGSASDIEGSPFNHRGSPSDLDGSPTPKRTGSTSDIEESPVKHRGS
SSDLEEEKPKMAAANSDSDNEDRPPSPAQKRHSNAHSDSETEIPKNKEPRELGGEKAEKK
GKWKAVMHSDSDDDMKARPTKAAPSSDPEDVPAKRVVDDSEDDDEMPMKRKKAILSDSED
EKADKPATKKSRAVSDDDNSDSEAGSDAPDKTMAKLRELGSDSEDEDARTKAEGGKKDEK
TLFGSDSESGDEEEKMIADIFGESDEEEEEFTGFNQEDLEGDKGHSKALEKKEVADDSDS
DEGVDRGGGQDTSFMSDFDVMLARKKAQSGKRRRNRDGGTFISDADDVVSAMITKMTEAA
EEDRTLNAQKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMTAIKEWIGPLPDKSLPAL
KIREELLKILQELPSVSQETLKHSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFG
LTSNYKGMTREERQQRDLDQQMPQKRRLSSGGQTPRRDLEKVLTGEEKALRPGDPGFCAR
ARVPMPSNKDYVVRPKWNVESESRSAPVKKGVSRVDKQLRRFADIKRMTKTGHAVKISVQ
GNRMPL
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggatggcgatgaggacgaatttttctccggaaatcactctgggtctgatgatggtggt
ggcaccccggtacaggacgaacatgctcctgattcagacgcggaagagatgagtgagccg
cgccactccgaggatgagggtagtgacggcgagggagctactagtgccatggagacaaat
ggcattgccagtgggtcagacaatgagggccctaaagtggccaacagtgactctgaggag
gaggcaccaaaccacagtgattcagaacctgaggcccccaggcctgcagacagtgatgcc
gaggagtccccagtgaagggcagaatcagcacctccgatgtggagggctctcctggaccc
gaacgcaggggcagcatctcagacattgaagggtcttcagtcaaacgtagaggcagcact
tcagacacagagggctctccagtcaatcgcagaagcagtccctcagatgtggatggccac
gccacttccaatcgcggaggtagtcattcagatgtggaaggctccccccttaccaaacac
aaagacagcaactctgatgttgagggttatcctgtcaaatgcaggggcagcgcctcagac
attgagggatctccattcaatcacagaggcagcccctcagatttagatggctcgcccaca
cctaaacgcacagggagcacctcagacattgaggagtctccagtcaaacacaggggcagc
tcatcagacttggaggaggaaaaacccaaaatggctgcagccaacagtgactcagataat
gaggaccggccaccgtccccagcccaaaaaagacactcgaatgcacacagtgactctgag
acagagataccgaaaaacaaagagccgagagagttgggtggggagaaggcagagaaaaag
gggaagtggaaggctgtgatgcactcggacagcgatgatgacatgaaggctcggcccaca
aaggcagcaccaagcagtgacccggaggacgttcctgcgaaacgggttgtggatgacagt
gaggatgatgatgaaatgccaatgaaaaggaagaaggccatcctatcagacagtgaagat
gagaaggcagacaaaccagctacgaagaaaagccgtgctgtgtcagacgatgacaactct
gacagcgaagccggctctgatgcgcctgacaaaacaatggccaaactgcgggagctgggc
tcggacagcgaagacgaggatgctaggacaaaggctgaaggaggaaagaaggatgagaaa
acactgtttggcagtgacagtgagtcaggcgatgaagaggagaaaatgattgcagacatc
tttggtgaatctgatgaagaggaagaagaatttacgggtttcaatcaggaggatctagaa
ggagataagggccattcaaaggccttggaaaagaaagaagttgctgatgactctgactct
gatgagggtgtggataggggtggtggccaagacaccagtttcatgtcagactttgatgta
atgctggctcgcaagaaggcccagagcgggaagcgcagacgaaaccgggacggtggaacg
ttcatcagtgacgctgatgatgtggtcagcgctatgatcactaagatgacggaggctgca
gaggaggacagaacgctgaatgctcagaagaagcccgccctaaaaaagttgactctactc
cctacagtagtgatgcacctgaaaaaacaggatctcaaggagacgttcatcgacagtggg
gtgatgactgccatcaaggagtggattggcccgctgccagacaagagccttccagctctt
aaaatcagagaggaactcctcaagatcctacaggaactccccagtgtgagtcaggagacg
ctcaaacacagtgggattggccgagcagtcatgttcctctacaaacaccccaaggaatca
cgtcccaacaaagatcttgccctcaaactaatcaatgagtggtcccgacccatctttgga
ctgacatccaactacaagggcatgacacgtgaggagagacaacagagagacctcgaccaa
cagatgcctcaaaaaagacgcctgagctcagggggacagactcctcgtagagacctggag
aaagtgctgacaggagaagagaaagctctacgcccaggtgaccctggcttctgtgcccgg
gctagggttcccatgccgtccaacaaggactatgtagtgaggcccaagtggaatgtggag
agtgaatccagatcggctccagtgaaaaagggtgtttcacgggtggacaaacagttacgc
cgctttgctgacatcaagcgtatgacaaagacaggtcatgcggtcaagatcagcgtccag
ggcaaccggatgcccctgtaa

DBGET integrated database retrieval system