KEGG   Esox lucius (northern pike): 105030097
Entry
105030097         CDS       T04894                                 

Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els01100  Metabolic pathways
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04371  Apelin signaling pathway
els04540  Gap junction
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105030097
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105030097
   04020 Calcium signaling pathway
    105030097
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105030097
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105030097
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105030097
   04914 Progesterone-mediated oocyte maturation
    105030097
   04916 Melanogenesis
    105030097
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105030097
   04270 Vascular smooth muscle contraction
    105030097
Enzymes [BR:els01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105030097
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA Aminopep DUF5408 Gastrin
Other DBs
NCBI-GeneID: 105030097
NCBI-ProteinID: XP_010902061
AA seq 1343 aa
MQDDALGYLVIGGDQSRDIQRTGSGEVASAGGEGDRGGDRSLELKDFTCATDGAFTREGV
VEKDGDIGKQRKDITGKTNDIRNHADDTGDYFSGDFESQSVLSENRDYIEVGKAKVDLIP
KPFKAQVFLRESLKVIITMNTGNHGTEIKRDSVNDRTKFHTNSYYDNIKPNTDTLETSTK
VNHEHSSDMKSKEFPTNSTIPHKDTFIKCAASPDNDDFNKDHTDDFMLKTNTYINNSDLT
KDFATTSCSLNHDSKTTTCVLSRDTTTSIFENVIPINQSDPGVDTDLDDSPDLVEGGRGA
FKRPSQNRLVEGMCCCYRAVHKAFLRCLEETPAVLPGLLLAMGFCIAIVILIPATGRNII
THVGALSVVCVVLCVSTALLVALPWLPVMRRCGGALSLFVWGMLYITAVVFIFTGGAITP
WEQVAFFLFLSLGVYTVLPLSLAWALIVGIGTSASHVIIISVYVPVTSPDTPYLAVQLVA
NAVLFVCVNCVGLFHLWSTEHARRKSSKKKEEFSTVRSQKDVQKHQQENLLLSLLPRYIA
KELKNEIIKRLSEKQEKGQNFHSLYIRQHKDVSILYADIVGFTQLASSCSPEELVAVLNK
LFGRFDDIAKKNECLRIKILGDCYYCVSGLPDPIPTHANNCVQMGLDMCTAINKLREATG
VEISMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMESGGLPGRVHITEETLGNLDG
AYQVEDTDGGSRDSMLIGRKTYLVIDPHKEHTTTKKKTNNLPVQFRKQRASVRMSQYLQS
WQTICPFSDLRNLETTPNNMPIFPIPARTNQSQPFADALPTHVNIHSGGQVLEDTLSGSL
DTISSVGRRAKKLNCLTLLFNDLNLEKQFHLSEVKGLHRSVGCLVLIFVCLFTVQMLVSN
RNFAMAVSYGITFPVLVLLLTVFCTSFLKKLRTKMPLSVQWVSSLPQKVATRAALRLILV
CLLLLITLLMAILNFFFLPGNNCTSINRTELQNLNLYTVPYYLYCCLLAMLGVVVFVTTC
LSAKVVLLTLAVVVYLALFLYVYAPRSDCYMALLYNDTKPGVLKEPKIMAGVWLFIFYFT
CLVMARQDELGCRVEFLLEQCFKKERDEMETMENVNKLLLQNVLPLHVASEFMGKSMHNQ
DLYSQSCELVCVMFASVPQFKEFYNESSMNHDGLECLRFLNEIISDFDELLSKPKFSSVE
KIKTIGSTYMAAAGLTNPALGEERKEGDASYHHIRSMVEFAIALKNNLEAINQHSFNSFK
LRIGINHGPVIAGVIGAQKPQYDIWGNSVNVASRMDSTGVLDKIQVTEETALVVETLGFS
VTKRGVITVKGKGELTTYFINTD
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgcaggacgatgccctgggatacctggtgattgggggagaccaatcaagggacattcag
aggacaggtagcggggaggttgctagcgcgggaggtgaaggagaccggggcggagacagg
agcctggagctgaaggattttacctgtgcaacagacggcgcttttaccagagaaggtgtc
gtggagaaagatggtgacatcggcaagcaaaggaaggatatcaccggaaaaacgaatgac
atcagaaatcatgctgatgacaccggggattacttcagtggggatttcgagagccaatca
gtgctcagcgagaatcgggactacatagaggtgggcaaggctaaggtggaccttattccc
aaacctttcaaggcccaggtatttttgagagaatcgctgaaggtcataattactatgaac
acaggtaaccatggcactgaaataaaacgagactctgtgaatgatagaaccaaattccac
actaactcttattatgataacattaaacccaacacagacactttagagactagcaccaaa
gtcaaccatgaacattcttcagacatgaagagcaaggaatttcccactaacagcacaatc
cctcacaaggacacttttattaaatgcgctgccagccctgacaatgatgactttaacaaa
gaccatacagatgactttatgttaaaaacaaatacttacattaacaactcagatctcacc
aaggacttcgcaacaacctcctgcagcctcaaccacgacagcaagacaaccacctgtgtt
ctgtcccgtgacactaccacttctatatttgaaaatgtcatccctattaaccagtcagac
cctggggtcgacaccgatttggatgacagcccggacctcgtggaggggggccgaggcgct
ttcaaacggccttcacagaacagattggtagaaggaatgtgctgctgctacagagccgta
cacaaggctttcctaaggtgcctggaggagacgccggccgtgttgcctggtctgctgttg
gccatgggcttctgcatagccattgtcatcctcataccagctacagggcggaacatcatc
acccacgtgggcgctctctccgtggtgtgcgtggtgctgtgcgtgagcaccgccctgctg
gtggccctgccctggctgcccgtgatgaggcgctgcgggggggcgctgtccctcttcgtc
tgggggatgttatacatcacggccgtggtcttcatcttcacggggggggccatcaccccg
tgggaacaggtggcgttcttcctcttcctgtctcttggggtgtacactgtgctgcccctg
tctttagcctgggctctgattgtgggcattgggaccagcgcgtcacacgtaataataatc
agcgtctacgtccctgtcaccagccctgacacaccatacctggctgtccagctggtggcc
aacgctgtgttgtttgtgtgtgtgaactgtgtgggcctgtttcacctgtggtcgactgaa
catgcccgaaggaaatccagtaagaagaaagaggagttcagcacagttcgctcccagaaa
gacgtacagaaacatcaacaggagaacctcctcctctccttgttgccacgctacattgcc
aaagagctgaagaatgagatcattaagcgactgtctgagaaacaagagaaaggacagaat
ttccacagtctttatatccggcagcacaaagatgtcagtattttatatgctgatatcgtg
gggtttacacagctggctagttcctgttctcctgaggagcttgtggcagtcctcaacaag
ctctttggcaggttcgatgacattgctaagaagaacgagtgtttgcgtataaagatccta
ggggactgttactactgtgtttccggtctgccagaccccatcccaacccacgccaacaac
tgtgttcagatgggtctcgacatgtgcaccgctatcaacaaactacgggaggccacaggt
gtggagattagcatgagggtgggtgtgcactccggcaatgttctctgtggcgtgataggt
ctacagaagtggcaatatgacgtctggtcacatgacgtgaccttggccaatcatatggag
tctgggggtttgccaggccgtgttcacatcacagaggagaccctgggaaacttagatgga
gcgtaccaagtggaagacactgatggagggagcagggactccatgctaattgggaggaaa
acatatctggttatcgacccccataaggaacacacaactaccaaaaagaagacaaacaac
ctgccggtccaatttcgtaagcagcgagcctcagtgaggatgtcccagtacctgcagtcc
tggcagaccatttgccccttctctgacctcagaaaccttgagaccacccccaacaatatg
ccgatcttcccgatacctgccagaactaaccaatcgcagccatttgcagatgctctgcct
acacacgtcaatatccacagtggtggtcaggtcctggaggacacccttagtgggtcctta
gataccatcagctctgtggggcgcagggcaaagaagctgaactgtctgacactgttattc
aatgacctgaacctggagaaacagtttcatctctcagaggtcaaaggtcttcaccgatct
gtaggctgcctggttctcatcttcgtgtgtctgtttacagtccaaatgcttgtctccaat
agaaactttgccatggctgtgtcgtacggaatcacctttcctgttctggtgctgcttctc
actgtgttctgcaccagtttcctcaagaaattgcgcaccaaaatgcctcttagtgtacag
tgggtgtcatcgctgccgcagaaagtggccaccagggcggcgctacgtctaatattggtc
tgcctcttactgctcatcaccctgctaatggccatactgaactttttttttttacctgga
aacaactgtacttccataaacagaacagaactacagaacctcaacctgtacaccgtccct
tattacctgtactgctgtctcctggctatgttaggtgtggtggtatttgtgacgacgtgt
ctgtcagccaaggtggtgctcctcaccctggctgtagtcgtctacctcgccctcttcctc
tacgtctacgctcctcgctccgactgctacatggcgctgctctacaatgacaccaagcct
ggagtcctaaaggagcctaagatcatggctggagtttggctgtttatcttctattttact
tgcctcgttatggcacgacaggacgagttaggctgtcgtgtggagttcctgctagagcag
tgctttaaaaaagaaagggatgagatggagaccatggagaacgtcaacaaactactgctg
cagaacgtcctgcctcttcatgtagcatcagaattcatgggcaagtccatgcacaatcag
gacctgtacagccagtcgtgtgaattggtgtgtgttatgttcgcctcagtgcctcagttt
aaggagttctacaacgagagcagcatgaaccatgacggactggaatgtctgcgttttctc
aatgagatcatctcagacttcgacgagcttctctctaagccaaagttctcttctgtggag
aagattaagaccattggcagtacctacatggccgctgctgggctgaccaatcctgctctg
ggggaggagcgaaaggaaggtgatgcatcctaccaccatatacgcagcatggtggagttt
gccatcgctttaaagaacaacctggaggccatcaaccaacactccttcaatagcttcaag
ctgcgcattgggataaaccatggtcccgtgattgcaggggtgattggagcccagaagcca
cagtatgatatctgggggaactctgttaacgtagccagtagaatggacagcaccggagta
ttggataagatccaggtgaccgaggagacggctctagtggtggagacattaggctttagt
gtcaccaagagaggagtcatcaccgtcaagggcaagggggaactgaccacctacttcatc
aacaccgactga

DBGET integrated database retrieval system