KEGG   Esox lucius (northern pike): 105030638Help
Entry
105030638         CDS       T04894                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC3 isoform X1
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105030638
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105030638
Membrane trafficking [BR:els04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    105030638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 105030638
NCBI-ProteinID: XP_010902923
UniProt: A0A3P8XUL6
AA seq 301 aa AA seqDB search
MAFLRCRRDPCGFICLILTYFSVFYADYVVIQYVLIPAYSGSMWCTLHGSVFNVILLLLL
ACHSKAVFSDPGMVPLPETAIDFSDLRSQNSRMNERGCEGWTVCSRCETYRPPRAHHCRV
CQRCIRRMDHHCPWINNCVGELNQKYFIQFLFYTGMASLYSMALVVSAWVWRIQSEREGE
GEKEEESPSKHLIVAHYIILLVESVLFGVFVMVIFYDQLVSIITDETPIEQMRNRLMKDR
SLTGSTSSQPPTHITHTRKPKLALLREVFGRGSVFCWLFPLHSSPPTVGGISYSAVPDYN
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctacgctgtaggcgagacccttgtggatttatatgtctcatattaacttat
ttcagcgtattttatgcggattatgtggtcattcagtatgtcctcattcctgcttactcg
ggaagtatgtggtgtacacttcatgggtctgtattcaatgtgattctcctgttgctgctg
gcctgccactccaaagccgtcttctctgacccgggcatggttccgcttccagagacagca
atagacttctctgatctgaggtcgcagaattcacgcatgaacgagaggggctgtgaaggc
tggactgtgtgtagtcgttgtgagacgtatcgacctcccagagcgcaccactgcagagtg
tgtcaacgatgcatacgacgtatggaccaccactgtccctggattaataactgtgttgga
gagctgaaccagaaatactttattcagttcctcttctatacaggtatggccagtctgtac
tccatggccctggtggtgtcggcctgggtgtggaggatacagagcgaaagagaaggagaa
ggagagaaagaagaggagtctcccagcaaacacctgattgtagctcactacatcattctg
ctggtggagtcggtgctgttcggtgtgtttgtcatggttattttctacgaccagttggtc
tccataataacggatgagactcccatagagcagatgaggaatcgcctgatgaaggacagg
tcgttgaccggcagcacctcctcccagcccccaactcacatcacgcacacccgcaagccc
aagctagccctgctcagggaggtcttcgggaggggttcggtgttctgttggctgttccct
ctacattccagcccccccacagttggtggaatcagctactcagctgtaccggattacaat
gtctaa

DBGET integrated database retrieval system