KEGG   Esox lucius (northern pike): 105030752Help
Entry
105030752         CDS       T04894                                 

Definition
(RefSeq) selenide, water dikinase 2
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00450  Selenocompound metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105030752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:els03016]
    105030752
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     105030752
Transfer RNA biogenesis [BR:els03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    105030752
 Prokaryotic Type
    105030752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 105030752
NCBI-ProteinID: XP_028979914
AA seq 331 aa AA seqDB search
MDSCVIPLRHGALSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLS
VSQKMSDKDRERVMPLMIRGFRDAAEEGGTSVTGGQTVVNPWIIVGGVASVVCQPNEFIM
PDSAVPGDVLVLTKPLGTQVAVNAHQWMDLPEKWNKIKLVVSKEEVEQAYQEAMFSMATL
NRTAAGLMHRFQAHAATDVTGFGLLGHARNLATTQRAEVAFVIHNLPIIAKMAAISKACG
NLFNLLGGTSSETSGGLLVCLPREQAARFCAEVKGQGSGGGAWIIGIVEKGERGARIIDK
PRIIEVPPRGTVAASQDNSSSASPAPIETLS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggactcctgtgtgatcccactcagacatggagccttatcattggtccaaactacagac
ttcttctaccctctggtggaagacccatacatgatgggaaggatagcgtgtgctaacgtc
ctcagtgatctctatgccatgggtatcacagagtgtgacaacatgttgatgctgcttagt
gtcagccagaaaatgtctgacaaggatcgtgagcgtgtgatgcccctgatgatccgtggt
ttccgtgatgctgcagaggagggagggacttcagtgacaggcggtcagactgtggtaaat
ccttggatcattgttggaggcgtggcctctgttgtctgccaacccaatgagttcatcatg
cctgacagtgcagtaccaggggatgtgttggtcctgaccaagcctctgggaacacaagtg
gctgtcaacgctcaccagtggatggatctgccagaaaagtggaataagataaagctggtg
gtctctaaggaggaagtggagcaggcctatcaggaagcaatgttttccatggcaacactc
aatcgcacagctgcaggcctaatgcacaggttccaggcccacgctgcaacagacgtgacc
gggttcgggttgctagggcacgcccgtaacctagcaacaacccagcgtgctgaggtagca
tttgtcatccataacctaccaatcattgccaagatggccgccatcagcaaggcctgtgga
aacctcttcaacctgttgggtgggacgtcttctgagacctctgggggcctgctggtgtgt
ctgcctagggagcaggcagccagattctgtgctgaggtgaagggtcagggatcagggggc
ggagcctggatcatcggcattgtggagaaaggagagcgcggagctcgtatcattgacaaa
ccacgcattattgaagtgccgcccagagggaccgttgcagccagtcaggataacagcagt
tctgctagtcccgcccccatcgaaacgttgtcatag

DBGET integrated database retrieval system