KEGG   Esox lucius (northern pike): 105030815Help
Entry
105030815         CDS       T04894                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC12
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105030815
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105030815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC TctB
Motif
Other DBs
NCBI-GeneID: 105030815
NCBI-ProteinID: XP_010903210
UniProt: A0A3P8Z0C7
AA seq 270 aa AA seqDB search
MFKNVFGSGFIVRTAHVVLTWVITLILFLHDTDLRKQEETGELIQPVLFVLLVLVSVLLY
FAISLMDPGFVLSDCSDLQFTLGVTEETQDMIPPTTKSLRQRRCGHCLLQQPMRSKHCQT
CQHCVRRYDHHCPWIENCVGERNHRWFVLYLAVQLLVLLWGLHVAWSGFTTAPTWQLWLR
RNGVLLGAAAVVAVLSLTVLLLLGSHLYLVSLNTTTWEFMSRHRISYLKHCGADENPFDR
GALRNLWGFFCGWGSVVWEQVYFREGSDPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaatgtgttcggatctggatttatcgtaagaaccgcgcatgttgtcttgaca
tgggtaataacactgatactgttcctgcatgatacagatctacggaagcaggaggagacg
ggagagctcatccagcccgtgctctttgtcctgctggtcctggtgtcggtgctgctgtac
tttgccatttcactcatggatccgggcttcgtcctatctgactgcagcgacttacagttt
accctgggtgtcactgaggagacacaggacatgattccgcccaccaccaagtctctacgg
caacggcgatgtggtcattgtctgctccagcagccaatgagatccaagcactgtcagacg
tgtcagcattgcgtgcgtcgctatgaccaccactgtccctggatcgagaactgtgtgggc
gagaggaaccaccgctggtttgtgctctacctggctgtccagcttctggtgctgctgtgg
ggactccacgtggcctggtcaggcttcaccacggcacccacgtggcagctgtggctgcgc
cgtaacggcgtgctgctgggggcagcggccgtggtggcggtgctctcactgaccgtcctc
ctcctcctgggctcccacctctacctggtctccctcaacaccaccacctgggagttcatg
tctcgccaccgcatctcctacctcaagcactgtggcgctgacgagaatccgtttgaccgc
ggcgcgctgcgcaacctctggggattcttctgtggctggggctctgtggtatgggagcag
gtgtacttcagggagggcagcgaccccatctga

DBGET integrated database retrieval system