KEGG   Esox lucius (northern pike): 106024841Help
Entry
106024841         CDS       T04894                                 

Gene name
crem
Definition
(RefSeq) cAMP-responsive element modulator isoform X4
  KO
K09052  cAMP response element modulator
Organism
els  Esox lucius (northern pike)
Pathway
els04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:els00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106024841 (crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    106024841 (crem)
Transcription factors [BR:els03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106024841 (crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 Rh5 Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 106024841
NCBI-ProteinID: XP_010883934
UniProt: A0A3P8XC76
AA seq 110 aa AA seqDB search
MAVTGDETESAATGEMSGYQICTPTSSLPQGVVMVESPGSMHSPQQMAEEATRKRELRLM
KNREAARECRRKKKEYVKCLENRVAVLENQNRTLIEELKALKDIYCRKPE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactggggatgagacagagtctgctgccactggtgaaatgtccggctaccag
atctgcacacccacctccagcctgcctcagggtgtagtgatggttgagtctccagggtcc
atgcacagcccccagcaaatggctgaggaggccacacgcaagagagagctccgcctcatg
aagaacagggaggctgcccgcgaatgtcgacggaagaagaaggaatatgtcaaatgtctt
gagaatcgagtggctgtgcttgagaatcaaaacaggactctcattgaggaactaaaagct
cttaaagacatctattgccgcaaacctgaatga

DBGET integrated database retrieval system