KEGG   Esox lucius (northern pike): 114828687Help
Entry
114828687         CDS       T04894                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like isoform X1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
els  Esox lucius (northern pike)
Pathway
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    114828687
Enzymes [BR:els01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     114828687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 114828687
NCBI-ProteinID: XP_028975398
AA seq 498 aa AA seqDB search
MLSKAQKSFRPVSITLRGLHQAARKVVERPEPEDNVTDSFGRFIQGVQSHHLTPTLLHRS
KRMVLDSLGVGLLGSTTHVFQLVLQHCQHMYAPADISSVYGRRGTKLSPTLAAFVNGVAT
HSMDFDDTWHPATHPSGAVLPALLALSDMLPSKPSGLDFLLAFNVGIEVQGRLMRFSNQA
QNIPKRFHPPSVVGTLGSAAACARLLCLDHAQCSHALAIAASLSGAPMANAATQSKPLHI
GNAARLGLEAALLASKGLEASRTILDDTTGVAGFSAFYEDYAVQPLTSPDEEGTRFLLED
QDMAFKRFPAHLGMHWVADAAAAIHKLLLGEPGVGSQGSGVVGQVQDILLRVPRSKYINR
PFPESEHEARHSFQFNACSALLHGEVTVDSFSQEAMRRPDLLTLLGRVHVEHPNDNPANF
DRMYGEVQVTLVGGDVLKGRCDTFYGHWRNPLTNESLLKKFCSNAGAVLPWEKVEGLIEA
VDGLETLGDCSSLLAQLQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaaagcacagaagtccttcaggcctgtgtccattacactgagaggacttcac
caggctgctcggaaagtggtagagcgtccagagccagaggataatgtgacggacagtttt
ggccgtttcatccagggtgtccagtcccatcacctgactcccactctgctccaccgctcc
aaacggatggtcctggacagcctgggggtgggcctgctgggcagcaccacacatgtcttc
cagttggtactacaacactgccagcacatgtatgctcctgctgacatcagcagtgtgtat
ggacgcagaggaaccaaactctccccaacactggctgccttcgtcaatggagttgccacc
cactccatggacttcgatgacacctggcaccctgctactcacccgtcgggggcggtcctt
cctgccttgctggcgcttagtgacatgttgcccagcaagccgagtgggctggacttcctg
ctggcgtttaacgtgggaatagaggttcagggacgacttatgaggttttccaatcaggct
caaaacatccccaagaggttccaccccccctctgtagtggggactctgggaagtgcagca
gcctgtgctcgactcctctgtttggatcacgctcaatgtagccacgccctggccatcgca
gccagcctatcaggagcccccatggctaatgccgccactcaatccaaacctctccatatt
ggcaatgcagcgcggctgggactagaggccgctctactggcctctaaagggctggaggcc
tcacgcaccatactggacgacaccactggtgtggcgggtttcagcgccttctacgaggac
tatgccgtgcaacctttgacctcccctgatgaggaagggacgcggttcctgttggaggac
caggacatggcgttcaagaggttccccgcccatctggggatgcactgggtggccgacgct
gctgctgccatacacaagctgctgctgggggaaccaggggtggggagtcaggggtcaggg
gtcgtagggcaggtccaggacatcctgcttagggttccgcgttccaaatacatcaaccgt
ccattcccagaatcagagcatgaggccagacattccttccagttcaacgcctgctctgcc
ctgctccacggcgaggtcaccgtggactcattttcccaggaggcaatgcggcgccccgac
ctgctgaccctgctcgggcgtgtccatgtggagcatcccaatgacaaccctgctaacttt
gaccgcatgtatggagaggtgcaggtgaccttggtgggcggggacgtactgaagggacgc
tgtgatacattctatggacattggagaaatccactgaccaatgagagtctgctgaagaag
ttctgtagtaacgcgggggcggtccttccctgggagaaggtggaggggctgattgaggcc
gtggatggcctggaaacactaggagactgctcttctctactggcacaattgcagtaa

DBGET integrated database retrieval system