KEGG   Esox lucius (northern pike): 114840675
Entry
114840675         CDS       T04894                                 

Definition
(RefSeq) aminopeptidase O-like
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    114840675
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     114840675
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   114840675
SSDB
Other DBs
NCBI-GeneID: 114840675
NCBI-ProteinID: XP_028980428
AA seq 237 aa
MGDDVNPDRDDLPLRANTSHILVRHYVLDLDIHFHTQVITGTLVLFLEPGPGAGEGAWAG
EGPGAGEGDLYTAQPSKTADSWEDESNGDFTLVLDCCDLAVSKVEELDVASVLDLQGLLE
EVRGEESVVEPQPGSQSAVLIQRLISLPATQWKKQHHLYSQCSRAPASESGRPLVFHTDR
WSLQVRHRGTRTPQEFPRALRICYETKPEGGSVRWTKDQDNRWSIKTNWKIYTAQRN
NT seq 714 nt   +upstreamnt  +downstreamnt
atgggtgatgatgtgaacccagacagagacgatctgcccctcagagccaacaccagccac
attctggtcagacactatgtcctggacctggacatacacttccacacgcaggttatcact
ggtactctggtgctgttcctggagcctggccctggggctggagaaggagcttgggctggg
gaaggacctggggctggggaaggtgatctatacactgcccaaccatctaagactgctgac
tcctgggaggacgagagtaacggagacttcaccttagttctggactgctgtgaccttgct
gtgtcaaaggttgaggagctggatgtggcatctgtcttggacctgcagggtctcctagaa
gaggtcaggggcgaggagtcggtggtggaaccacaaccaggcagccaatcagctgtgctc
attcagaggctgatatcccttcctgccacccagtggaaaaagcaacatcacctgtactct
cagtgcagtcgtgcccctgcttctgagagtgggagaccccttgtcttccacactgatcgt
tggagcctgcaagtgcggcatagggggactcggacgccccaggagttcccccgagccctg
cgaatctgctatgagaccaagccagagggaggctctgtcaggtggactaaagaccaggac
aacaggtggagtatcaagacaaactggaaaatatacactgctcaaagaaattaa

DBGET integrated database retrieval system